Set cath from cathlist by auto on 05 Mar 2006 18:09
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1itkA01 | 53 | 182 |
| 1itkA01 | 403 | 414 |
| 1itkA02 | 233 | 266 |
| 1itkA02 | 303 | 402 |
| 1itkA03 | 436 | 580 |
| 1itkA03 | 710 | 731 |
| 1itkA04 | 581 | 709 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1itkA02 SAKNIRQTFDRMAMNDKETAALIAGGHTFGKVHGITSGIEGPWTQSPTEWDMGYINNLLDYEWEPEKGPGGAWQWAPKSE ELKNSVPDAHDPDEKQTPMMLTTDIALKRDPDYREVMETFQENPMEFGMNFAKA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"