CATH Domain: 1irxA02 XML data for domain: 1irxA02

Molscript image for 1irxA02
1irxA02
PDB coordinates for domain 1irxA02

PDB 1irx, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.300 class i lysyl-tRNA synthetase like Gene3D
2.30.30.300.1
2.30.30.300.1.1
2.30.30.300.1.1.1
2.30.30.300.1.1.1.1
2.30.30.300.1.1.1.1.1

[top]
Segment boundaries for domain 1irxA02

Chopping figure for domain 1irxA02
DomainStart PDB ResidueStop PDB Residue
1irxA01 3 169
1irxA01 213 269
1irxA02 170 212
1irxA03 270 317
1irxA04 318 430
1irxA05 431 523

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.30.30.300.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mmdA01 85.04 ActomyosinMyosin II complexActin-myosin filament slidingProtein localizationActin filament binding 2.30.30.360 48 11 81 1.74 2.14
1sf9A02 78.83 Bacillus subtilisUncharacterized protein yfhH 2.30.30.340 54 11 77 3.15 4.05
1t3bA01 78.24 Thiol:disulfide interchange protein DsbC [EC:5.3.4.1]Haemophilus influenzaeThiol:disulfide interchange protein dsbC 3.10.450.70 48 6 85 3.48 4.07
2aklA01 76.00 Phosphonate and phosphinate metabolismPseudomonas aeruginosaPhosphonoacetate hydrolase [EC:3.11.1.2]Putative uncharacterized protein 2.20.25.10 43 11 83 3.71 4.43
1nuiA01 74.76 Enterobacteria phage T7DNA primase/helicase 2.20.25.10 43 6 55 2.33 4.17
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1irxA02
WWPAMVYCPEHRREAEIIEWDGGWKVKYKCPEGHEGWVDIRSG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1irxA02
WWPAMVYCPEHRREAEIIEWDGGWKVKYKCPEGHEGWVDIRSG
BLAST against CATH

[top]
Domain History Events (88)

Domain assigned by cuff on 20 Oct 2008 15:24

very nice structural matches with other domains in same fold but different superfamilies. No functional evidence avialable or sequence ID. Have to create another superfamily for now

Homcheck comment by cuff on 14 Jul 2008 13:57

yep - same fold different superfamily

Domain assignment manual match t by yan on 25 Jun 2008 11:46

high SSAP score and nice overlapping, no function match

Homcheck review by yan on 25 Jun 2008 11:46

high SSAP score and nice overlapping, no function match

Flow stage update by yan on 25 Jun 2008 11:46

high SSAP score and nice overlapping, no function match

Homcheck allotment by yan on 24 Jun 2008 17:52

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by yan on 24 Jun 2008 17:52

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Feb 2008 19:03

Calculated SCOP results for 1irxA02 and inserted them into the database.

Domain scan scop cath by auto on 07 Feb 2008 19:03

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 66 results for 1irxA02

Flow stage update by auto on 22 Dec 2007 15:12

Retrieved PRC_PFAMCATH results for job ID SID0653661102397936 and results inserted.

Domain scan prc pfamcath by auto on 22 Dec 2007 15:12

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 22 results for 1irxA02

Update comment by auto on 22 Dec 2007 00:02

PRC_PFAMCATH job SID0653661102397936 is not yet finished.

Prc pfamcath submit by auto on 22 Dec 2007 00:01

The entry "1irxA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 22 Dec 2007 00:01

The entry "1irxA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 21 Dec 2007 23:51

Retrieved SSAP results for job ID SID5077269154213248 and results inserted.

Domain scan ssap cath by auto on 21 Dec 2007 23:48

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1157 results for 1irxA02

Update comment by auto on 21 Dec 2007 20:47

SSAP job SID5077269154213248 is not yet finished.

Ssap cath submit by auto on 21 Dec 2007 20:42

The entry "1irxA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Dec 2007 20:42

The entry "1irxA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Dec 2007 20:31

Retrieved PRC results for job ID SID9377762333094664 and inserted them into the database.

Domain scan prc cath by auto on 21 Dec 2007 20:30

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 1irxA02

Update comment by auto on 21 Dec 2007 18:19

PRC job SID9377762333094664 is not yet finished.

Prc cath submit by auto on 21 Dec 2007 18:15

The entry "1irxA02" has been submitted to the PRC webservice.

Flow stage update by auto on 21 Dec 2007 18:15

The entry "1irxA02" has been submitted to the PRC webservice.

Flow stage update by auto on 21 Dec 2007 18:06

Retrieved HMM(SAM) results for job ID SID4347020212025504 and inserted them into the database.

Domain scan sam cath by auto on 21 Dec 2007 18:06

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 1irxA02

Update comment by auto on 21 Dec 2007 14:20

HMM(SAM) job SID4347020212025504 is not yet finished.

Flow stage update by auto on 21 Dec 2007 14:16

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 21 Dec 2007 14:16

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 21 Dec 2007 11:58

Unable to retrieve "1irxA02" HMM(SAM) results for job "SID0166791010913128"

Update comment by auto on 21 Dec 2007 08:53

HMM(SAM) job SID0166791010913128 is not yet finished.

Flow stage update by auto on 21 Dec 2007 08:49

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 21 Dec 2007 08:49

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 21 Dec 2007 05:27

Unable to retrieve "1irxA02" HMM(SAM) results for job "SID1719361033938816"

Update comment by auto on 21 Dec 2007 03:01

HMM(SAM) job SID1719361033938816 is not yet finished.

Flow stage update by auto on 21 Dec 2007 02:56

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 21 Dec 2007 02:56

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 23:39

Unable to retrieve "1irxA02" HMM(SAM) results for job "SID4733115492556096"

Update comment by auto on 20 Dec 2007 20:35

HMM(SAM) job SID4733115492556096 is not yet finished.

Sam cath submit by auto on 20 Dec 2007 20:32

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 20:32

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 17:32

Unable to retrieve "1irxA02" HMM(SAM) results for job "SID9255469740639120"

Update comment by auto on 20 Dec 2007 14:47

HMM(SAM) job SID9255469740639120 is not yet finished.

Sam cath submit by auto on 20 Dec 2007 14:45

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 14:45

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 11:36

Unable to retrieve "1irxA02" HMM(SAM) results for job "SID7550454088841632"

Update comment by auto on 20 Dec 2007 08:26

HMM(SAM) job SID7550454088841632 is not yet finished.

Flow stage update by auto on 20 Dec 2007 08:24

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 20 Dec 2007 08:24

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 08:22

Retrieved "1irxA02" CATHEDRAL results for job ID SID5492539110630632 and inserted them into the database.

Domain scan cathedral cath by auto on 20 Dec 2007 08:21

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 87 results for 1irxA02

Update comment by auto on 20 Dec 2007 05:18

"1irxA02" CATHEDRAL job SID5492539110630632 is not yet finished.

Cathedral cath submit by auto on 20 Dec 2007 05:15

The entry "1irxA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 20 Dec 2007 05:15

The entry "1irxA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 20 Dec 2007 05:14

ScanList with 11654 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1irxA02.scanlist" for "1irxA02"

Write scan list by auto on 20 Dec 2007 05:14

Writing ScanList containing 11654 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1irxA02.scanlist" for domain "1irxA02"

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Flow stage update by auto on 24 May 2007 04:20

Retrieved PRC_PFAMCATH results for job ID SID0343320458725056 and chopping inserted.

Domain scan prc pfamcath by auto on 24 May 2007 04:19

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 18 results for 1irxA02

Prc pfamcath submit by auto on 24 May 2007 04:13

The entry "1irxA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 May 2007 04:13

The entry "1irxA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 May 2007 03:48

Retrieved SSAP results for job ID SID3958804437307952 and chopping inserted.

Domain scan ssap cath by auto on 24 May 2007 03:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 871 results for 1irxA02

Update comment by auto on 23 May 2007 22:16

SSAP job SID3958804437307952 is not yet finished.

Ssap cath submit by auto on 23 May 2007 22:13

The entry "1irxA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 May 2007 22:13

The entry "1irxA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 May 2007 22:10

Retrieved PRC results for job ID SID4270533370376402 and inserted them into the database.

Domain scan prc cath by auto on 23 May 2007 22:10

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 1irxA02

Update comment by auto on 23 May 2007 18:20

PRC job SID4270533370376402 is not yet finished.

Prc cath submit by auto on 23 May 2007 18:16

The entry "1irxA02" has been submitted to the PRC webservice.

Flow stage update by auto on 23 May 2007 18:16

The entry "1irxA02" has been submitted to the PRC webservice.

Flow stage update by auto on 23 May 2007 18:12

Retrieved HMM(SAM) results for job ID SID0155995516042880 and inserted them into the database.

Domain scan sam cath by auto on 23 May 2007 18:11

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 1irxA02

Update comment by auto on 23 May 2007 17:13

HMM(SAM) job SID0155995516042880 is not yet finished.

Sam cath submit by auto on 23 May 2007 17:11

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 23 May 2007 17:11

The entry "1irxA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 23 May 2007 17:00

Retrieved "1irxA02" CATHEDRAL results for job ID SID3401441953534240 and inserted them into the database.

Domain scan cathedral cath by auto on 23 May 2007 16:59

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 204 results for 1irxA02

Cathedral cath submit by auto on 23 May 2007 16:50

The entry "1irxA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 23 May 2007 16:50

The entry "1irxA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 23 May 2007 16:45

ScanList with 8775 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1irxA02.scanlist" for "1irxA02"

Write scan list by auto on 23 May 2007 16:45

Writing ScanList containing 8775 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1irxA02.scanlist" for domain "1irxA02"

Flow stage update by auto on 23 May 2007 16:42

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Mar 2007 15:08

No in_process hits for Domain "1irxA02" ready to be processed

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1irxA02"

Flow stage update by auto on 14 Mar 2007 15:01

All required files are present for Domain "1irxA02"

Flow stage update by auto on 14 Mar 2007 14:59

Beginning processing for Domain "1irxA02"

Insertion by cuff on 05 Jan 2007 13:25

fine, chop :)