CATH Domain: 1iqqA00 XML data for domain: 1iqqA00

Molscript image for 1iqqA00
1iqqA00
PDB coordinates for domain 1iqqA00

PDB 1iqq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.730 Ribonuclease Rh; Chain A
3.90.730.10 Ribonuclease Rh; Chain A Gene3D
3.90.730.10.2
3.90.730.10.2.1
3.90.730.10.2.1.1
3.90.730.10.2.1.1.1
3.90.730.10.2.1.1.1.1

[top]
Segment boundaries for domain 1iqqA00

Chopping figure for domain 1iqqA00
DomainStart PDB ResidueStop PDB Residue
1iqqA00 1 200

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.90.730.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1iooA00 87.60 Nicotiana alataRibonuclease S-F11 3.90.730.10 196 24 93 2.00 2.14
1iybA00 87.23 Ribonuclease NWNicotiana glutinosa 3.90.730.10 208 29 91 2.39 2.62
1jy5A00 86.62 Calystegia sepiumRNase-like protein 3.90.730.10 203 25 91 3.58 3.91
1bolA00 83.03 Ribonuclease RhRhizopus niveus 3.90.730.10 222 21 77 3.05 3.91
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iqqA00
YDYFQFTQQYQLAVCNSNRTLCKDPPDKLFTVHGLWPSNMVGPDPSKCPIKNIRKREKLLEHQLEIIWPNVFDRTKNNLF
WDKEWMKHGSCGYPTIDNENHYFETVIKMYISKKQNVSRILSKAKIEPDGKKRALLDIENAIRNGADNKKPKLKCQKKGT
TTELVEITLCSDKSGEHFIDCPHPFEPISPHYCPTNNIKY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iqqA00
YDYFQFTQQYQLAVCNSNRTLCKDPPDKLFTVHGLWPSNMVGPDPSKCPIKNIRKREKLLEHQLEIIWPNVFDRTKNNLF
WDKEWMKHGSCGYPTIDNENHYFETVIKMYISKKQNVSRILSKAKIEPDGKKRALLDIENAIRNGADNKKPKLKCQKKGT
TTELVEITLCSDKSGEHFIDCPHPFEPISPHYCPTNNIKY
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:59

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"