Set cath from cathlist by auto on 05 Mar 2006 19:36
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 4 matching structural neighberhood comparisons for CATH ID 3.90.730.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1iooA00 | 87.60 | 3.90.730.10 | 196 | 24 | 93 | 2.00 | 2.14 | |
![]() |
1iybA00 | 87.23 | 3.90.730.10 | 208 | 29 | 91 | 2.39 | 2.62 | |
![]() |
1jy5A00 | 86.62 | 3.90.730.10 | 203 | 25 | 91 | 3.58 | 3.91 | |
![]() |
1bolA00 | 83.03 | 3.90.730.10 | 222 | 21 | 77 | 3.05 | 3.91 |
>pdb|1iqqA00 YDYFQFTQQYQLAVCNSNRTLCKDPPDKLFTVHGLWPSNMVGPDPSKCPIKNIRKREKLLEHQLEIIWPNVFDRTKNNLF WDKEWMKHGSCGYPTIDNENHYFETVIKMYISKKQNVSRILSKAKIEPDGKKRALLDIENAIRNGADNKKPKLKCQKKGT TTELVEITLCSDKSGEHFIDCPHPFEPISPHYCPTNNIKY
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"