Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1iq8A01 | 6 | 360 |
| 1iq8A02 | 361 | 430 |
| 1iq8A03 | 431 | 504 |
| 1iq8A04 | 505 | 582 |
There are 1 matching structural neighberhood comparisons for CATH ID 2.30.130.10.4.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1q7hA02 | 90.23 | 2.30.130.10 | 81 | 26 | 90 | 1.61 | 1.79 |
>pdb|1iq8A04 YPRMRVVVNKEAEPFARKGKDVFAKFVIFADPGIRPYDEVLVVNENDELLATGQALLSGREMIVFQYGRAVKVRKGVE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"