CATH Domain: 1iq8A03 XML data for domain: 1iq8A03

Molscript image for 1iq8A03
1iq8A03
PDB coordinates for domain 1iq8A03

PDB 1iq8, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.90 Gene3D
3.10.450.90.1
3.10.450.90.1.1
3.10.450.90.1.1.1
3.10.450.90.1.1.1.1
3.10.450.90.1.1.1.1.1

[top]
Segment boundaries for domain 1iq8A03

Chopping figure for domain 1iq8A03
DomainStart PDB ResidueStop PDB Residue
1iq8A01 6 360
1iq8A02 361 430
1iq8A03 431 504
1iq8A04 505 582

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.450.90.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2q07A02 83.01 Archaeosine tRNA-ribosyltransferase [EC:2.4.2.-]Archaeoglobus fulgidusPutative uncharacterized protein 3.10.450.90 63 23 85 2.50 2.94
1q7hA01 78.80 PUA domain proteinThermoplasma acidophilumPutative uncharacterized protein Ta1423 3.10.450.120 63 11 81 3.72 4.59
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iq8A03
PTKEDAIKYVMAIAEYQFGEGASRAFDDAKVELSKTGMPRQVKVNGKRLATVRADDGLLTLGIEGAKRLHRVLP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iq8A03
PTKEDAIKYVMAIAEYQFGEGASRAFDDAKVELSKTGMPRQVKVNGKRLATVRADDGLLTLGIEGAKRLHRVLP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:54

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:54

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:52

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"