CATH Domain: 1iq0A03 XML data for domain: 1iq0A03

Molscript image for 1iq0A03
1iq0A03
PDB coordinates for domain 1iq0A03

PDB 1iq0, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.730 Isoleucyl-tRNA Synthetase; Domain 1
1.10.730.10 Isoleucyl-tRNA Synthetase; Domain 1 Gene3D
1.10.730.10.4
1.10.730.10.4.2
1.10.730.10.4.2.1
1.10.730.10.4.2.1.1
1.10.730.10.4.2.1.1.1

[top]
Segment boundaries for domain 1iq0A03

Chopping figure for domain 1iq0A03
DomainStart PDB ResidueStop PDB Residue
1iq0A01 101 476
1iq0A02 1 100
1iq0A03 477 592

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.730.10.4.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1f7uA02 90.91 Aminoacyl-tRNA biosynthesisArginyl-tRNA synthetase, cytoplasmicArginine-tRNA ligase activityArginyl-tRNA synthetase [EC:6.1.1.19]Arginyl-tRNA aminoacylation 1.10.730.10 125 27 91 1.42 1.56
1wkbA03 80.75 Leucyl-tRNA synthetase [EC:6.1.1.4]Aminoacyl-tRNA biosynthesisPyrococcus horikoshiiLeucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 1.10.730.10 121 9 82 3.37 4.08
1qsdA00 79.09 Beta-tubulin bindingPost-chaperonin tubulin folding pathwayCytoplasmMicrotubule cytoskeleton organizationSaccharomyces cerevisiae 1.20.58.90 102 4 63 2.89 4.53
1rqgA04 78.75 Aminoacyl-tRNA biosynthesisSelenoamino acid metabolismPyrococcus abyssiMethionyl-tRNA synthetaseMethionyl-tRNA synthetase [EC:6.1.1.10] 1.10.730.10 151 12 74 3.08 4.12
1qu3A04 76.42 Aminoacyl-tRNA biosynthesisIsoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseStaphylococcus aureusValine, leucine and isoleucine biosynthesis 1.10.730.10 150 9 72 3.10 4.31
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iq0A03
HARAHSILRKAGEWGAPDLSQATPYERALALDLLDFEEAVLEAAEERTPHVLAQYLLDLAASWNAYYNARENGQPATPVL
TAPEGLRELRLSLVQSLQRTLATGLDLLGIPAPEVM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iq0A03
HARAHSILRKAGEWGAPDLSQATPYERALALDLLDFEEAVLEAAEERTPHVLAQYLLDLAASWNAYYNARENGQPATPVL
TAPEGLRELRLSLVQSLQRTLATGLDLLGIPAPEVM
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:52

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"