CATH Domain: 1iowA03 XML data for domain: 1iowA03

Molscript image for 1iowA03
1iowA03
PDB coordinates for domain 1iowA03

PDB 1iow, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.4
3.30.1490.20.4.1
3.30.1490.20.4.1.1
3.30.1490.20.4.1.1.1
3.30.1490.20.4.1.1.1.1

[top]
Segment boundaries for domain 1iowA03

Chopping figure for domain 1iowA03
DomainStart PDB ResidueStop PDB Residue
1iowA01 1 84
1iowA02 85 110
1iowA02 184 306
1iowA03 111 183

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ehiA03 90.48 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 30 93 2.06 2.21
1bxrA07 88.13 3.30.1490.20 70 20 90 1.87 2.07
3g8dB03 87.08 Pyruvate metabolismFatty acid biosynthesisPropanoate metabolismMetabolic pathwaysFatty acid biosynthetic process 3.30.1490.20 73 24 91 2.59 2.82
1w96A03 85.51 Endoplasmic reticulum membraneAcetyl-CoA carboxylaseProtein import into nucleusBiotin carboxylase [EC:6.3.4.14]Nuclear envelope organization 3.30.1490.20 63 22 83 2.37 2.84
1i7nA01 85.47 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 21 82 2.62 3.19
1gsaA03 84.49 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingCytosol 3.30.1490.20 65 13 83 2.88 3.45
1vkzA02 82.89 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 11 87 2.60 2.97
3ethA03 82.66 Purine metabolismMetabolic pathways5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]Phosphoribosylaminoimidazole carboxylase ATPase subunitEscherichia coli K-12 3.30.1490.20 62 24 83 2.66 3.18
2nu8B02 82.41 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 16 76 2.55 3.35
2r85A03 79.24 Pyrococcus furiosus5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC:6.3.4.-]Purine metabolism5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetaseMetabolic pathways 3.30.1490.20 58 13 71 3.54 4.97
1a0iA01 78.88 Enterobacteria phage T7DNA ligase 3.30.1490.70 83 9 69 3.29 4.71
2r6fA03 78.15 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 11 76 3.50 4.56
1ta8A02 75.26 DNA ligase (NAD+) [EC:6.5.1.2]DNA replicationNucleotide excision repairBase excision repairDNA ligase 3.30.1490.70 99 2 63 3.13 4.92
1x9nA02 74.55 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 6 66 3.11 4.69
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iowA03
VAPWVALTRAEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIEKWL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iowA03
VAPWVALTRAEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIEKWL
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1iow003" to "1iowA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:51

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"