CATH Domain: 1iowA02 XML data for domain: 1iowA02

Molscript image for 1iowA02
1iowA02
PDB coordinates for domain 1iowA02

PDB 1iow, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.7
3.30.470.20.7.1
3.30.470.20.7.1.1
3.30.470.20.7.1.1.1
3.30.470.20.7.1.1.1.1

[top]
Segment boundaries for domain 1iowA02

Chopping figure for domain 1iowA02
DomainStart PDB ResidueStop PDB Residue
1iowA01 1 84
1iowA02 85 110
1iowA02 184 306
1iowA03 111 183

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.470.20.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ehiA02 87.64 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.470.20 144 21 83 2.49 2.97
1i7nA03 77.54 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.470.20 119 10 71 3.13 4.36
1gsaA02 77.45 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingEscherichia coli K-12 3.30.470.20 121 12 75 3.06 4.03
2pn1A03 76.73 Pyrimidine metabolismExiguobacterium sibiricum 255-15Alanine, aspartate and glutamate metabolismCarbamoyl-phosphate synthase large subunit [EC:6.3.5.5]Metabolic pathways 3.30.470.20 116 13 63 2.98 4.67
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1iowA02
GSGVMASALSMDKLRSKLLWQGAGLPSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKFLSDETQYFCPAGLEASQEANL
QALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILELAD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1iowA02
GSGVMASALSMDKLRSKLLWQGAGLPSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKFLSDETQYFCPAGLEASQEANL
QALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILELAD
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1iow002" to "1iowA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:51

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"