Set cath from cathlist by auto on 05 Mar 2006 19:36
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 3 matching structural neighberhood comparisons for CATH ID 3.90.730.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1iybA00 | 88.31 | 3.90.730.10 | 208 | 28 | 91 | 1.96 | 2.15 | |
![]() |
1jy5A00 | 86.38 | 3.90.730.10 | 203 | 26 | 92 | 3.97 | 4.31 | |
![]() |
1bolA00 | 83.05 | 3.90.730.10 | 222 | 18 | 77 | 2.15 | 2.77 |
>pdb|1iooA00 DFEYLQLVLTWPASFCYANHCERIAPNNFTIHGLWPDNVKTRLHNCKPKPTYSYFTGKMLNDLDKHWMQLKFEQDYGRTE QPSWKYQYIKHGSCCQKRYNQNTYFGLALRLKDKFDLLRTLQTHRIIPGSSYTFQDIFDAIKTVSQENPDIKCAEVTKGT PELYEIGICFTPNADSMFRCPQSDTCDKTAKVLFRR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"