Set cath from cathlist by auto on 05 Mar 2006 18:05
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1iomA01 | 13 | 220 |
| 1iomA01 | 323 | 356 |
| 1iomA02 | 221 | 322 |
There are 3 matching structural neighberhood comparisons for CATH ID 1.10.230.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1vgmA02 | 91.28 | 1.10.230.10 | 104 | 44 | 98 | 2.01 | 2.05 | |
![]() |
1a59A02 | 88.50 | 1.10.230.10 | 108 | 31 | 91 | 2.42 | 2.64 | |
![]() |
1cscA02 | 85.06 | 1.10.230.10 | 112 | 21 | 87 | 2.91 | 3.33 |
>pdb|1iomA02 GANEAVMRMIQEIGTPERAREWVREKLAKKERIMGMGHRVYKAFDPRAGVLEKLARLVAEKHGHSKEYQILKIVEEEAGK VLNPRGIYPNVDFYSGVVYSDL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"