CATH Domain: 1io2A02 XML data for domain: 1io2A02

Molscript image for 1io2A02
1io2A02
PDB coordinates for domain 1io2A02

PDB 1io2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.460 Ribonuclease hii. Domain 2 Gene3D
1.10.10.460.2
1.10.10.460.2.1
1.10.10.460.2.1.1
1.10.10.460.2.1.1.1
1.10.10.460.2.1.1.1.1

[top]
Segment boundaries for domain 1io2A02

Chopping figure for domain 1io2A02
DomainStart PDB ResidueStop PDB Residue
1io2A01 2 161
1io2A02 162 208

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1io2A02
EYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1io2A02
EYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKV
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 17:56

Assigning to "1.10.10.460" based on similarity with "1ekeB02" (NWSI: 51.9230769230769, NWO: 94.5454545454545, SPS: 94.67, SPO: 100, RMSD: 1.35)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1io2A02"

Flow stage update by auto on 28 Apr 2006 17:42

All required files are present for Domain "1io2A02"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1io2A02"

Insertion by auto on 05 Mar 2006 16:51

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"