Set cath from cathlist by auto on 05 Mar 2006 19:06
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1imvA02
1imvA02
PDB 1imv, Chain A, Domain 2
Segment boundaries for domain 1imvA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1imvA01 | 16 | 28 |
| 1imvA01 | 193 | 299 |
| 1imvA01 | 342 | 398 |
| 1imvA02 | 29 | 192 |
| 1imvA02 | 300 | 341 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.497.10.12.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1f0cA01 | 79.53 | 3.30.497.10 | 161 | 15 | 71 | 2.75 | 3.83 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1imvA02 VPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGADERTESIIHRALYYDLISSPDIHGTYKELLDT VTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLL GVAHSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAG
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 19:06
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 16:51
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
