Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1imvA01 | 16 | 28 |
| 1imvA01 | 193 | 299 |
| 1imvA01 | 342 | 398 |
| 1imvA02 | 29 | 192 |
| 1imvA02 | 300 | 341 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1imvA01 TGALVEEEDPFFKFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLP LKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLFEWNEDGAGTTHLTFPLDYHLNQPFIFVLRDTDTGALLFI GKILDPRGP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"