CATH Domain: 1imlA00 XML data for domain: 1imlA00

Molscript image for 1imlA00
1imlA00
PDB coordinates for domain 1imlA00

PDB 1iml, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.10 Ribbon
2.10.110 Cysteine Rich Protein
2.10.110.10 Cysteine Rich Protein Gene3D
2.10.110.10.3
2.10.110.10.3.1
2.10.110.10.3.1.1
2.10.110.10.3.1.1.1
2.10.110.10.3.1.1.1.1

[top]
Segment boundaries for domain 1imlA00

Chopping figure for domain 1imlA00
DomainStart PDB ResidueStop PDB Residue
1imlA00 1 76

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.10.110.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1b8tA01 84.55 Cysteine and glycine-rich protein 1Gallus gallusCysteine and glycine-rich protein 2.10.110.10 69 39 81 2.12 2.60
1b8tA02 83.14 Cysteine and glycine-rich protein 1Gallus gallusCysteine and glycine-rich protein 2.10.110.10 63 44 78 2.76 3.50
1nypA00 81.93 Cell agingZinc ion bindingLIM and senescent cell antigen-like-containing domain protein 1Homo sapiensProtein binding 2.10.110.10 66 30 80 3.30 4.11
1x6aA01 80.53 LIM domain kinase 2NucleusHomo sapiensProtein serine/threonine kinase activityMitochondrion 2.10.110.10 62 17 77 2.83 3.65
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1imlA00
PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1imlA00
PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1iml000" to "1imlA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:46

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"