CATH Domain: 1ileA03 XML data for domain: 1ileA03

Molscript image for 1ileA03
1ileA03
PDB coordinates for domain 1ileA03

PDB 1ile, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.730 Isoleucyl-tRNA Synthetase; Domain 1
1.10.730.10 Isoleucyl-tRNA Synthetase; Domain 1 Gene3D
1.10.730.10.9
1.10.730.10.9.1
1.10.730.10.9.1.1
1.10.730.10.9.1.1.1
1.10.730.10.9.1.1.1.1

[top]
Segment boundaries for domain 1ileA03

Chopping figure for domain 1ileA03
DomainStart PDB ResidueStop PDB Residue
1ileA01 1 195
1ileA01 391 630
1ileA02 196 390
1ileA03 631 821

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.730.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gaxA02 81.35 Aminoacyl-tRNA biosynthesisValyl-tRNA synthetase [EC:6.1.1.9]Valyl-tRNA synthetaseValine, leucine and isoleucine biosynthesisThermus thermophilus 1.10.730.10 227 20 73 3.27 4.44
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ileA03
GPNLVRETVRDYFLTLWNVYSFFVTYANLDRPDLKNPPPPEKRPEMDRWLLARMQDLIQRVTEALEAYDPTTSARALRDF
VVEDLSQWYVRRNRRRFWKNEDALDREAAYATLYEALVLVATLAAPFTPFLAEVLWQNLVRSVRLEAKESVHLADWPEAD
PALADEALVAQMRAVLKVVDLARAARAKSGV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ileA03
GPNLVRETVRDYFLTLWNVYSFFVTYANLDRPDLKNPPPPEKRPEMDRWLLARMQDLIQRVTEALEAYDPTTSARALRDF
VVEDLSQWYVRRNRRRFWKNEDALDREAAYATLYEALVLVATLAAPFTPFLAEVLWQNLVRSVRLEAKESVHLADWPEAD
PALADEALVAQMRAVLKVVDLARAARAKSGV
BLAST against CATH

[top]
Domain History Events (5)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ile003" to "1ileA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1ile003 to 1.10.730.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1ile001 (from the previous chopping at "Sun Mar 5 16:51:42 2006") which was in 1.10.730.10 at the time the chain was unchopped.

Flow stage update by auto on 06 Jan 2007 23:40

All required files are present for Domain "1ile003"

Flow stage update by auto on 06 Jan 2007 23:39

Beginning processing for Domain "1ile003"

Insertion by cuff on 05 Jan 2007 16:07

fine. chop