Domain assigned by auto on 28 Apr 2006 17:59
Assigning to "1.10.2000.10" based on similarity with "1ijxE00" (NWSI: 42.5196850393701, NWO: 96.1538461538462, SPS: 91.16, SPO: 95, RMSD: 2.41)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ijyA00 ELACQEITVPLCKGIGYEYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVC ERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYER
Assigning to "1.10.2000.10" based on similarity with "1ijxE00" (NWSI: 42.5196850393701, NWO: 96.1538461538462, SPS: 91.16, SPO: 95, RMSD: 2.41)
NW result present for Domain "1ijyA00"
All required files are present for Domain "1ijyA00"
Beginning processing for Domain "1ijyA00"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"