Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1iirA01 | 1 | 218 |
| 1iirA01 | 383 | 401 |
| 1iirA02 | 219 | 382 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.2000.13.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1pswA02 | 78.08 | 3.40.50.2000 | 174 | 14 | 80 | 4.02 | 5.00 | |
![]() |
2qr3A00 | 74.57 | 3.40.50.2300 | 119 | 13 | 68 | 3.33 | 4.87 |
>pdb|1iirA02 ILPDERPLSPELAAFLDAGPPPVYLGFGAPADAVRVAIDAIRAHGRRVILSRGWADLVLPDDGADCFAIGEVNHQVLFGR VAAVIHHGGAGTTHVAARAGAPQILLPQMADQPYYAGRVAELGVGVAHDGPIPTFDSLSAALATALTPETHARATAVAGT I
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"