Set cath from cathlist by auto on 05 Mar 2006 19:38
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 3 matching structural neighberhood comparisons for CATH ID 4.10.520.10.2.1.1.2.3 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1owfA00 | 89.38 | 4.10.520.10 | 96 | 30 | 96 | 2.15 | 2.22 | |
![]() |
2np2A00 | 88.88 | 4.10.520.10 | 102 | 29 | 92 | 1.61 | 1.75 | |
![]() |
1exeA00 | 79.68 | 4.10.520.10 | 99 | 26 | 93 | 3.34 | 3.56 |
>pdb|1ihfB00 MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF KPGKELRDRANIYG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"