CATH Domain: 1ihfB00 XML data for domain: 1ihfB00

Molscript image for 1ihfB00
1ihfB00
PDB coordinates for domain 1ihfB00

PDB 1ihf, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.520 HU Protein; Chain A
4.10.520.10 HU Protein, subunit A Gene3D
4.10.520.10.2
4.10.520.10.2.1
4.10.520.10.2.1.1
4.10.520.10.2.1.1.2
4.10.520.10.2.1.1.2.3

Segment boundaries for domain 1ihfB00

Chopping figure for domain 1ihfB00
DomainStart PDB ResidueStop PDB Residue
1ihfB00 1 94

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 4.10.520.10.2.1.1.2.3 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1owfA00 89.38 Integration host factor subunit alphaTranscriptionIntegration host factor subunit alphaTranscription activator activityTranscription repressor activity 4.10.520.10 96 30 96 2.15 2.22
2np2A00 88.88 Borrelia burgdorferiIntegration host factor subunit betaHbb 4.10.520.10 102 29 92 1.61 1.75
1exeA00 79.68 Transcription factor 1Bacillus phage SPO1 4.10.520.10 99 26 93 3.34 3.56
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|1ihfB00
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF
KPGKELRDRANIYG    

Domain COMBS Sequence

>pdb|1ihfB00
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF
KPGKELRDRANIYG    

Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"