CATH Domain: 1ig8A02 XML data for domain: 1ig8A02

Molscript image for 1ig8A02
1ig8A02
PDB coordinates for domain 1ig8A02

PDB 1ig8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.12
3.30.420.40.12.1
3.30.420.40.12.1.1
3.30.420.40.12.1.1.1
3.30.420.40.12.1.1.1.1

[top]
Segment boundaries for domain 1ig8A02

Chopping figure for domain 1ig8A02
DomainStart PDB ResidueStop PDB Residue
1ig8A01 18 76
1ig8A02 77 210
1ig8A03 211 486

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.420.40.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1czaN03 85.38 Type II diabetes mellitusGalactose metabolismAmino sugar and nucleotide sugar metabolismButirosin and neomycin biosynthesisHexokinase [EC:2.7.1.1] 3.30.420.40 178 41 73 1.52 2.07
1woqA01 81.77 Inorganic polyphosphate/ATP-glucomannokinaseArthrobacter sp. KM 3.30.420.40 112 19 82 2.78 3.39
1z05A02 80.02 Vibrio choleraeTranscriptional regulator, ROK family 3.30.420.40 154 14 72 2.93 4.07
2hoeA02 77.83 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 146 11 74 3.40 4.55
3h1qA02 75.35 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 10 64 3.11 4.79
2gupA01 75.33 ROK family proteinStreptococcus pneumoniae 3.30.420.40 96 15 70 3.45 4.87
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ig8A02
KESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEPIPLGFT
FSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALIN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ig8A02
KESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEPIPLGFT
FSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALIN
BLAST against CATH

[top]
Domain History Events (4)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1ig8A02 to 3.30.420.40 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1ig8A03 (from the previous chopping at "Sun Mar 5 16:50:51 2006") which was in 3.30.420.40 at the time the chain was unchopped.

Flow stage update by auto on 06 Jan 2007 23:40

All required files are present for Domain "1ig8A02"

Flow stage update by auto on 06 Jan 2007 23:39

Beginning processing for Domain "1ig8A02"

Insertion by cuff on 05 Jan 2007 17:11

selection of choppings