CATH Domain: 1ifqB00 XML data for domain: 1ifqB00

Molscript image for 1ifqB00
1ifqB00
PDB coordinates for domain 1ifqB00

PDB 1ifq, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.50 Gene3D
3.30.450.50.2
3.30.450.50.2.1
3.30.450.50.2.1.1
3.30.450.50.2.1.1.1
3.30.450.50.2.1.1.1.1

[top]
Segment boundaries for domain 1ifqB00

Chopping figure for domain 1ifqB00
DomainStart PDB ResidueStop PDB Residue
1ifqB00 0 127

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.450.50.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2j3wA00 82.35 Mus musculusTrafficking protein particle complex subunit 2 3.30.450.70 142 8 85 2.83 3.29
2vglS00 80.15 Huntington's diseaseEndocytosisMus musculusAP-2 complex subunit sigmaAP-2 complex subunit sigma-1 3.30.450.60 142 8 83 3.32 3.96
2vglM01 79.85 Huntington's diseaseEndocytosisRattus norvegicusClathrin vesicle coatAP-2 complex subunit mu-1 3.30.450.60 141 6 83 3.81 4.55
1nrjA00 77.72 SRP-dependent cotranslational protein targeting to membraneGTP bindingProtein bindingSignal recognition particle receptor complexSignal recognition particle receptor subunit alpha 3.30.450.60 147 4 75 3.73 4.94
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ifqB00
GSVLLTIARVADGLPLAASQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGATFHYIIEQGVCYLVLCEAAFPKK
LAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ifqB00
MRGSHHHHHHGSVLLTXIARVADGLPLAASXQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAXTFHYIIEQGV
CYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"