CATH Domain: 1ifpA00 XML data for domain: 1ifpA00

Molscript image for 1ifpA00
1ifpA00
PDB coordinates for domain 1ifpA00

PDB 1ifp, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.440 Gene3D
1.20.5.440.6
1.20.5.440.6.1
1.20.5.440.6.1.1
1.20.5.440.6.1.1.1
1.20.5.440.6.1.1.1.1

[top]
Segment boundaries for domain 1ifpA00

Chopping figure for domain 1ifpA00
DomainStart PDB ResidueStop PDB Residue
1ifpA00 1 44

Structural Neighbourhood (48 entries)

There are 48 matching structural neighberhood comparisons for CATH ID 1.20.5.440.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 48 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1kilE00 87.83 Complexin-1Syntaxin-1 bindingRattus norvegicusDendriteSynaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex 1.20.5.580 41 9 93 1.94 2.08
1hf9A00 87.63 Protein homodimerization activityNegative regulation of hydrolase activityATPase inhibitor activityBos taurusATPase binding 1.20.5.500 41 4 93 1.49 1.60
1r8eA03 87.10 Multidrug-efflux transporter 1 regulatorBacillus subtilis 1.20.5.490 44 9 97 2.26 2.31
3gwoA00 85.81 Human immunodeficiency virus type 1 lw12.3 isolateEnvelope glycoprotein gp160 1.10.287.210 53 52 73 1.07 1.45
1ezjA02 84.18 Sendai virus (strain Harris)Phosphoprotein 1.10.287.340 52 2 78 2.59 3.28
2v7qJ00 83.99 Protein homodimerization activityNegative regulation of hydrolase activityATPase inhibitor activityBos taurusCalmodulin binding 1.20.5.500 43 4 70 1.19 1.69
3effK02 83.48 Streptomyces lividansVoltage-gated potassium channel 1.20.5.440 45 4 82 2.09 2.54
2qjyC01 83.20 Oxidative phosphorylationMetabolic pathwaysRhodobacter sphaeroidesUbiquinol-cytochrome c reductase iron-sulfur subunitUbiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] 1.20.5.510 33 12 75 1.33 1.77
1s5lX00 82.76 Photosystem II reaction center X proteinThermosynechococcus elongatus BP-1 1.20.5.510 40 7 79 2.39 3.00
1ik7A00 82.74 Regulation of proteolysisProtein domain specific bindingHemocyte proliferationPlasma membraneZygotic specification of dorsal/ventral axis 1.20.5.530 52 6 76 2.66 3.46
1kv4A00 82.41 Moricin-1Bombyx mori 1.20.5.750 42 11 77 2.14 2.77
1e5wA04 82.27 Leukocyte migrationReceptor bindingCytoskeletonMembrane to membrane dockingNucleolus 1.20.5.450 55 9 80 3.40 4.25
2zjsE00 81.92 Protein exportBacterial secretion systemThermus thermophilus HB8Preprotein translocase subunit secEPreprotein translocase subunit SecE 1.20.5.1030 46 9 89 3.73 4.18
1vf5C03 81.63 Mastigocladus laminosusApocytochrome f 1.20.5.700 32 3 70 2.05 2.91
3e7kA00 81.01 Rattus norvegicusCalcium channel activityCalcium ion transportIntegral to membraneProtein binding 1.20.5.1010 54 4 59 1.20 2.02
1l2pA00 81.00 Oxidative phosphorylationMetabolic pathwaysATP synthesis coupled proton transportAnchored to membraneF-type H+-transporting ATPase subunit b [EC:3.6.3.14] 1.20.5.620 61 11 68 2.44 3.54
1vl2B03 80.70 Thermotoga maritimaArginine and proline metabolismArgininosuccinate synthase [EC:6.3.4.5]Alanine, aspartate and glutamate metabolismArgininosuccinate synthase 1.20.5.470 30 16 68 2.71 3.97
1kqfB03 80.69 Two-component systemMetabolic pathwaysGlyoxylate and dicarboxylate metabolismMethane metabolismFormate dehydrogenase activity 1.20.5.480 44 9 100 4.33 4.33
1ybkA00 80.18 TetrabrachionStaphylothermus marinus 1.20.5.1060 52 9 57 1.31 2.27
1fdoA05 80.18 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 1.20.5.460 27 7 61 1.95 3.18
2w83C00 79.87 Homo sapiensIntegral to membraneC-Jun-amino-terminal kinase-interacting protein 4SpermatogenesisPositive regulation of cell migration 1.20.5.1000 67 9 65 2.13 3.24
1hj0A00 79.76 Bos taurusThymosin beta-10 1.20.5.520 41 4 77 2.55 3.30
2r9iA00 79.67 Putative phage capsid proteinCorynebacterium diphtheriae 1.10.287.80 69 11 63 1.95 3.06
1omiA02 79.64 Listeria monocytogenesListeriolysin regulatory protein 1.20.5.460 27 3 61 1.66 2.71
1uixA00 79.43 Chemokine signaling pathwayRho-associated, coiled-coil containing protein kinase [EC:2.7.11.1]Leukocyte transendothelial migrationWnt signaling pathwayTGF-beta signaling pathway 1.20.5.730 68 9 54 1.39 2.55
1go9A00 79.10 1.20.5.480 39 10 79 3.47 4.36
1h8bB00 79.06 TitinOryctolagus cuniculus 1.20.5.510 23 8 52 1.82 3.48
1gmjD00 78.91 Negative regulation of hydrolase activityProtein homodimerization activityATPase inhibitor activityBos taurusCalmodulin binding 1.20.5.500 56 11 62 2.58 4.13
1k04A01 78.27 Focal adhesion kinase 1Focal adhesionIntegrin-mediated signaling pathwayCytoskeletonHomo sapiens 1.20.5.540 38 21 56 2.19 3.85
1ow6A01 78.01 Focal adhesion kinase 1Focal adhesionCytoskeletonIntegrin-mediated signaling pathwayHomo sapiens 1.20.5.540 30 26 56 2.40 4.22
1kmiZ01 77.25 Bacterial chemotaxisChemotaxis protein cheZProtein bindingChemotaxis protein CheZEscherichia coli K-12 1.20.5.590 30 0 59 2.38 4.03
1xrdA01 76.02 Light-harvesting complex 1 alpha chainRhodospirillum rubrumLight-harvesting protein B-870 alpha chain 1.20.5.890 43 6 77 3.46 4.48
2zvoB00 75.67 Mus musculusNF-kappa-B essential modulatorActivation of NF-kappaB-inducing kinase activityB cell homeostasis 1.20.5.990 88 6 50 1.53 3.06
1t6aA01 75.53 Geobacillus stearothermophilusRbstp2229 protein 1.20.5.850 43 4 47 1.01 2.12
2v4hB00 73.86 Mus musculusNF-kappa-B essential modulatorActivation of NF-kappaB-inducing kinase activityB cell homeostasis 1.20.5.990 91 4 48 1.47 3.04
1fd9A02 73.78 FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC:5.2.1.8]Outer membrane protein MIPLegionella pneumophila subsp. pneumophila str. Philadelphia 1 1.10.287.460 98 9 44 2.11 4.70
1pl5A00 73.20 Chromatin silencing complexLoss of chromatin silencing involved in replicative cell agingChromatin silencingDouble-strand break repair via nonhomologous end joiningDouble-stranded DNA binding 1.20.5.730 75 6 42 1.36 3.19
2o01J01 72.78 Photosystem I reaction center subunit IXSpinacia oleracea 1.20.5.510 25 8 56 2.81 4.95
1qbzA00 72.44 Simian immunodeficiency virusEnvelope glycoprotein 1.10.287.210 102 9 43 1.78 4.13
1l8dA00 72.41 Exonuclease SbcCPyrococcus furiosusDNA double-strand break repair rad50 ATPase 1.10.287.510 103 2 39 1.52 3.82
2spcA00 71.91 Oocyte constructionSpectrosome organizationPlasma membrane organizationNegative regulation of microtubule depolymerizationGermarium-derived female germ-line cyst formation 1.20.58.60 107 4 41 1.79 4.35
3c8vA04 71.58 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 1.20.5.510 19 0 36 0.71 1.95
2qiwA02 69.48 Corynebacterium glutamicumPEP phosphonomutase and related enzymes 1.20.5.510 18 5 40 1.28 3.13
1d66B02 67.52 Regulatory protein GAL4NucleusSequence-specific DNA binding transcription factor activityTranscription activator activityPositive regulation of transcription by galactose 1.20.5.640 15 6 34 0.64 1.88
1onvB00 66.45 CTD phosphatase activityProtein dephosphorylationHomo sapiensRNA polymerase II subunit A C-terminal domain phosphataseDNA-directed RNA polymerase activity 1.20.5.670 21 4 40 1.96 4.79
3b8mC02 65.96 Escherichia coli O157:H7Ferric enterobactin (Enterochelin) transport 1.10.287.210 104 4 27 1.13 4.05
1mkmA02 65.16 Thermotoga maritimaTranscriptional regulator, IclR family 1.20.5.640 14 7 31 0.71 2.23
1bg1A01 63.56 Temperature homeostasisRegulation of multicellular organism growthEye photoreceptor cell differentiationTranscription from RNA polymerase II promoterEating behavior 1.20.1050.20 175 9 25 1.14 4.53
[1]
Displaying entries 1 to 48 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ifpA00
MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ifpA00
MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF
BLAST against CATH

[top]
Domain History Events (42)

Domain assigned by cuff on 20 Oct 2008 13:31

homology match

Domain assignment manual match h by tronnberg on 11 Dec 2007 09:57

SSAP: 89.0 OV: 86 SEQ: 15. Both are viral protein.

Homcheck review by tronnberg on 11 Dec 2007 09:57

SSAP: 89.0 OV: 86 SEQ: 15. Both are viral protein.

Flow stage update by tronnberg on 11 Dec 2007 09:57

SSAP: 89.0 OV: 86 SEQ: 15. Both are viral protein.

Homcheck allotment by tronnberg on 11 Dec 2007 09:52

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 11 Dec 2007 09:52

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 15:21

Calculated SCOP results for 1ifpA00 and inserted them into the database.

Domain scan scop cath by auto on 09 Dec 2007 15:21

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 81 results for 1ifpA00

Flow stage update by auto on 08 Dec 2007 18:58

Retrieved PRC_PFAMCATH results for job ID SID7207622756266688 and results inserted.

Domain scan prc pfamcath by auto on 08 Dec 2007 18:58

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 1ifpA00

Update comment by auto on 08 Dec 2007 14:54

PRC_PFAMCATH job SID7207622756266688 is not yet finished.

Prc pfamcath submit by auto on 08 Dec 2007 14:47

The entry "1ifpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 14:47

The entry "1ifpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 14:41

Retrieved SSAP results for job ID SID3236779176545688 and results inserted.

Domain scan ssap cath by auto on 08 Dec 2007 14:40

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1604 results for 1ifpA00

Update comment by auto on 08 Dec 2007 03:16

SSAP job SID3236779176545688 is not yet finished.

Ssap cath submit by auto on 08 Dec 2007 02:54

The entry "1ifpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 08 Dec 2007 02:54

The entry "1ifpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 08 Dec 2007 02:47

Retrieved PRC results for job ID SID3336536077128512 and inserted them into the database.

Domain scan prc cath by auto on 08 Dec 2007 02:47

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 1ifpA00

Update comment by auto on 07 Dec 2007 19:36

PRC job SID3336536077128512 is not yet finished.

Flow stage update by auto on 07 Dec 2007 19:30

The entry "1ifpA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 07 Dec 2007 19:30

The entry "1ifpA00" has been submitted to the PRC webservice.

Flow stage update by auto on 07 Dec 2007 19:23

Retrieved HMM(SAM) results for job ID SID0958904087575360 and inserted them into the database.

Domain scan sam cath by auto on 07 Dec 2007 19:23

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 1ifpA00

Update comment by auto on 07 Dec 2007 14:37

HMM(SAM) job SID0958904087575360 is not yet finished.

Sam cath submit by auto on 07 Dec 2007 14:31

The entry "1ifpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 07 Dec 2007 14:31

The entry "1ifpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 07 Dec 2007 14:21

Retrieved "1ifpA00" CATHEDRAL results for job ID SID0556170713350472 and inserted them into the database.

Domain scan cathedral cath by auto on 07 Dec 2007 14:21

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 237 results for 1ifpA00

Update comment by auto on 06 Dec 2007 06:24

"1ifpA00" CATHEDRAL job SID0556170713350472 is not yet finished.

Cathedral cath submit by auto on 06 Dec 2007 06:21

The entry "1ifpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 06 Dec 2007 06:21

The entry "1ifpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 06 Dec 2007 06:20

ScanList with 11651 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1ifpA00.scanlist" for "1ifpA00"

Write scan list by auto on 06 Dec 2007 06:20

Writing ScanList containing 11651 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1ifpA00.scanlist" for domain "1ifpA00"

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ifp000" to "1ifpA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Flow stage update by auto on 18 Aug 2007 06:17

No satisfactory AssignClose result found.

Flow stage update by auto on 18 Aug 2007 06:10

No in_process hits for Domain "1ifp000" ready to be processed

Flow stage update by auto on 18 Aug 2007 06:10

NW result present for Domain "1ifp000"

Flow stage update by auto on 16 Aug 2007 17:14

All required files are present for Domain "1ifp000"

Flow stage update by auto on 16 Aug 2007 00:02

Beginning processing for Domain "1ifp000"

Insertion by cuff on 15 Aug 2007 13:04

nice chopping