Set cath from cathlist by auto on 05 Mar 2006 18:02
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.10.10.143.1.2.1.2 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1pp8O00 | 78.49 | 1.10.10.10 | 97 | 10 | 66 | 2.92 | 4.42 | |
![]() |
1gvjA00 | 78.32 | 1.10.10.10 | 141 | 11 | 56 | 2.17 | 3.87 |
>pdb|1if1A00 RMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMN SLPDIEEVKDQSRNKGSSAVRVYRM
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"