Set cath from cathlist by auto on 05 Mar 2006 19:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1iejA01 | 5 | 81 |
| 1iejA01 | 251 | 316 |
| 1iejA02 | 82 | 250 |
| 1iejA02 | 317 | 327 |
There are 11 matching structural neighberhood comparisons for CATH ID 3.40.190.10.16.1.1.1.1 (SIMAX score < 5)
>pdb|1iejA01 SVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAITLDGGQVFEAGLAPYKLKPIAAEVAVV ARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLFKDSAIMLKRVPSLMDS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"