CATH Domain: 1id0A00 XML data for domain: 1id0A00

Molscript image for 1id0A00
1id0A00
PDB coordinates for domain 1id0A00

PDB 1id0, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.12
3.30.565.10.12.1
3.30.565.10.12.1.1
3.30.565.10.12.1.1.1
3.30.565.10.12.1.1.1.1

[top]
Segment boundaries for domain 1id0A00

Chopping figure for domain 1id0A00
DomainStart PDB ResidueStop PDB Residue
1id0A00 335 480

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.565.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gkzA01 85.75 ATP bindingMitochondrial alpha-ketoglutarate dehydrogenase complexRattus norvegicus[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4][3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase activity 3.30.565.10 159 15 89 3.14 3.49
1r62A00 85.00 Two-component systemIdentical protein bindingTwo-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3]Escherichia coli K-12Nitrogen regulation protein NR(II) 3.30.565.10 136 19 82 2.73 3.29
1bxdA00 81.34 Two-component systemOsmolarity sensor protein envZTwo-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]Protein bindingEscherichia coli K-12 3.30.565.10 161 19 83 3.44 4.13
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1id0A00
RELHPVAPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVE
DDGPGIPLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1id0A00
RELHPVAPLLDNLTSALNKVYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVE
DDGPGIPLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQHSAPKDE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"