CATH Domain: 1ichA00 XML data for domain: 1ichA00

Molscript image for 1ichA00
1ichA00
PDB coordinates for domain 1ichA00

PDB 1ich, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.11
1.10.533.10.11.1
1.10.533.10.11.1.1
1.10.533.10.11.1.1.1
1.10.533.10.11.1.1.1.1

[top]
Segment boundaries for domain 1ichA00

Chopping figure for domain 1ichA00
DomainStart PDB ResidueStop PDB Residue
1ichA00 327 413

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.533.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ngrA00 84.54 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 17 88 2.37 2.68
1a1wA00 76.40 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 14 85 3.37 3.96
1ddfA00 76.32 Type I diabetes mellitusPathways in cancerSoluble fractionChagas diseaseAutoimmune thyroid disease 1.10.533.10 127 18 67 3.29 4.86
1n3kA00 74.81 Astrocytic phosphoprotein PEA-15Cricetulus griseus 1.10.533.10 130 4 60 2.74 4.57
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ichA00
PATLYAVVENVPPLRWKEFVKRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLE
DIEEALC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ichA00
MAHKPQSLDTDDPATLYAVVENVPPLRWKEFVKRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGR
VLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:34

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"