Set cath from cathlist by auto on 05 Mar 2006 19:02
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ia8A01 | 2 | 97 |
| 1ia8A02 | 98 | 276 |
There are 51 matching structural neighberhood comparisons for CATH ID 3.30.200.20.10.1.1.1.1 (SIMAX score < 5)
>pdb|1ia8A01 AVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFL EYCSGGELFDRIE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"