CATH Domain: 1i7nA03 XML data for domain: 1i7nA03

Molscript image for 1i7nA03
1i7nA03
PDB coordinates for domain 1i7nA03

PDB 1i7n, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.11
3.30.470.20.11.1
3.30.470.20.11.1.1
3.30.470.20.11.1.1.1
3.30.470.20.11.1.1.1.1

[top]
Segment boundaries for domain 1i7nA03

Chopping figure for domain 1i7nA03
DomainStart PDB ResidueStop PDB Residue
1i7nA01 249 308
1i7nA02 113 215
1i7nA02 395 407
1i7nA03 216 248
1i7nA03 309 394

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.470.20.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gsaA02 80.11 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingEscherichia coli K-12 3.30.470.20 121 13 85 3.34 3.92
1kblA06 74.31 Clostridium symbiosumPyruvate, phosphate dikinase 3.30.470.20 98 6 66 3.02 4.55
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1i7nA03
SLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYK
LWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1i7nA03
SLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYK
LWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:50

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"