CATH Domain: 1i7nA01 XML data for domain: 1i7nA01

Molscript image for 1i7nA01
1i7nA01
PDB coordinates for domain 1i7nA01

PDB 1i7n, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.12
3.30.1490.20.12.1
3.30.1490.20.12.1.1
3.30.1490.20.12.1.1.1
3.30.1490.20.12.1.1.1.1

[top]
Segment boundaries for domain 1i7nA01

Chopping figure for domain 1i7nA01
DomainStart PDB ResidueStop PDB Residue
1i7nA01 249 308
1i7nA02 113 215
1i7nA02 395 407
1i7nA03 216 248
1i7nA03 309 394

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ehiA03 86.56 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 15 86 2.17 2.50
2nu8B02 80.42 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 18 71 2.82 3.95
1m0wB05 78.89 Glutathione synthase [EC:6.3.2.3]Glutathione bindingProtein homodimerization activityGlutathione metabolismMetabolic pathways 3.30.1490.50 60 6 88 4.11 4.65
3l4jA02 78.82 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1490.30 47 8 68 2.70 3.95
1fviA01 78.35 Paramecium bursaria Chlorella virus 1A544R protein 3.30.1490.70 79 11 67 3.33 4.96
3kalA05 77.87 Homoglutathione synthetaseGlycine max 3.30.1490.50 61 5 88 4.21 4.76
3c6mC01 77.19 Spermine synthaseArginine and proline metabolismSpermine synthase [EC:2.5.1.22]Glutathione metabolismMetabolic pathways 3.30.160.110 44 4 63 2.78 4.39
2r6fA03 77.09 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 3 74 3.03 4.08
2pbzA03 74.77 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC:6.3.4.-]Purine metabolismThermococcus kodakarensisMetabolic pathwaysPutative uncharacterized protein 3.30.1490.20 38 10 53 2.14 4.01
1b33N01 72.58 Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, coreMastigocladus laminosus 3.30.1490.170 55 3 70 3.36 4.80
1bjtA01 70.35 Reciprocal meiotic recombinationRegulation of mitotic recombinationDNA topoisomerase 2DNA strand elongation involved in DNA replicationDNA topoisomerase II [EC:5.99.1.3] 3.30.1490.30 43 4 46 2.29 4.91
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1i7nA01
EQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1i7nA01
EQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:50

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"