Set cath from cathlist by auto on 05 Mar 2006 18:08
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1i7dA01 | 1 | 156 |
| 1i7dA02 | 157 | 216 |
| 1i7dA02 | 489 | 608 |
| 1i7dA03 | 218 | 287 |
| 1i7dA03 | 418 | 488 |
| 1i7dA04 | 290 | 416 |
There are 1 matching structural neighberhood comparisons for CATH ID 1.10.290.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1gkuB08 | 86.12 | 1.10.290.10 | 119 | 20 | 82 | 2.72 | 3.29 |
>pdb|1i7dA04 LPFSLSALQIEAAKRFGLSAQNVLDICQKLYETHKLITFPRSDCRYLPEEHFAGRHAVMNAISVHAPDLLPQPVVDPDIR NRCWDDKKVDAHHAIIPTARSSAINLTENEAKVYNLIARQYLMQFCP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"