Set cath from cathlist by auto on 05 Mar 2006 18:47
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1i7dA01 | 1 | 156 |
| 1i7dA02 | 157 | 216 |
| 1i7dA02 | 489 | 608 |
| 1i7dA03 | 218 | 287 |
| 1i7dA03 | 418 | 488 |
| 1i7dA04 | 290 | 416 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1i7dA03 AKDFFEVKAHIVTPADERFTAIWQPSEACEPYQDEEGRLLHRPLAEHVVNRISGQPAIVTSYNDKRESESAVFRKCVIEL DIAKGKFVAKARFLAEAGWRTLLGSKERDEENDGTPLPVVAKGDELLCEKGEVVERQTQPP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"