Set cath from cathlist by auto on 05 Mar 2006 18:09
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1i7dA02
1i7dA02
PDB 1i7d, Chain A, Domain 2
Segment boundaries for domain 1i7dA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1i7dA01 | 1 | 156 |
| 1i7dA02 | 157 | 216 |
| 1i7dA02 | 489 | 608 |
| 1i7dA03 | 218 | 287 |
| 1i7dA03 | 418 | 488 |
| 1i7dA04 | 290 | 416 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 1.10.460.10.2.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1gkuB06 | 85.70 | 1.10.460.10 | 156 | 23 | 84 | 2.33 | 2.76 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1i7dA02 PLCVSALARARADWLYGINMTRAYTILGRNAGYQGVLSVGRVQTPVLGLVVRRDEEIENFRHFTDATLLSAMTGIARFVQ DKDLKKILRATDGLGTEATRAGIIELLFKRGFLTKKGRYIHSTDAGKALFHSLPEMATRPDMTAHWESVLTQISEKQCRY QDFMQPLVGTLYQLIDQAKR
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 18:09
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 16:50
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
