Insertion by sillitoe on 06 Mar 2006 15:40
HomCheck 'Assigned H' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1i5pA01 | 264 | 272 |
| 1i5pA01 | 485 | 633 |
| 1i5pA02 | 30 | 263 |
| 1i5pA03 | 273 | 470 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1i5pA03 ANLYASGSGPQQTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGVSSGLIG ATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLSLRCGAFSARGNSNYFPDYFIRNISGVPLV IRNEDLTRPLHYNQIRNIESPSGTPGGARAYLVSVHNR
HomCheck 'Assigned H' domains
HomCheck 'Assigned H' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"