CATH Domain: 1i52A00 XML data for domain: 1i52A00

Molscript image for 1i52A00
1i52A00
PDB coordinates for domain 1i52A00

PDB 1i52, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.550 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
3.90.550.10 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Gene3D
3.90.550.10.11
3.90.550.10.11.1
3.90.550.10.11.1.1
3.90.550.10.11.1.1.1
3.90.550.10.11.1.1.1.1

[top]
Segment boundaries for domain 1i52A00

Chopping figure for domain 1i52A00
DomainStart PDB ResidueStop PDB Residue
1i52A00 5 229

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.90.550.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2px7A00 87.29 Terpenoid backbone biosynthesisMetabolic pathwaysThermus thermophilus HB82-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 3.90.550.10 203 33 90 2.02 2.24
1w55A01 86.15 Terpenoid backbone biosynthesis2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]Campylobacter jejuniBifunctional enzyme ispD/ispFProtein binding 3.90.550.10 207 26 90 2.06 2.27
1eziA00 80.91 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysN-acylneuraminate cytidylyltransferaseN-acylneuraminate cytidylyltransferase [EC:2.7.7.43]Neisseria meningitidis 3.90.550.10 211 12 86 3.13 3.61
1e5kA00 79.75 Molybdopterin-guanine dinucleotide biosynthesis protein AEscherichia coli K-12Molybdopterin-guanine dinucleotide biosynthesis protein A 3.90.550.10 188 18 80 3.16 3.95
1qwjB00 79.57 Mus musculusN-acylneuraminate cytidylyltransferase 3.90.550.10 229 13 87 3.20 3.66
1tzfA00 78.42 Amino sugar and nucleotide sugar metabolismStarch and sucrose metabolismMetabolic pathwaysGlucose-1-phosphate cytidylyltransferase [EC:2.7.7.33]Glucose-1-phosphate cytidylyltransferase 3.90.550.10 251 12 76 3.15 4.12
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1i52A00
HLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISPGDSRFAQLPLANHPQITVVDGGDE
RADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARLLALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHAL
TPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1i52A00
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISPGDSRFAQLPLANHPQITVVD
GGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARLLALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGL
WHALTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:58

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"