Set cath from cathlist by auto on 05 Mar 2006 19:17
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1i36A01 | 1 | 159 |
| 1i36A02 | 160 | 264 |
There are 23 matching structural neighberhood comparisons for CATH ID 3.40.50.720.132.1.1.1.1 (SIMAX score < 5)
>pdb|1i36A01 LRVGFIGFGEVAQTLASRLRSRGVEVVTSLEGRSPSTIERARTVGVTETSEEDVYSCPVVISAVTPGVALGAARRAGRHV RGIYVDINNISPETVRMASSLIEKGGFVDAAIMGSVRRKGADIRIIASGRDAEEFMKLNRYGLNIEVRGREPGDASAIK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"