CATH Domain: 1i12D00

There are 40 matching structural neighberhood comparisons for CATH ID 3.40.630.30.1.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3fb3A00	89.62	Amino sugar and nucleotide sugar metabolismGlucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]N-acetyltransferase, putativeTrypanosoma brucei	3.40.630.30	141	32	89	1.51	1.68
	2dxqA00	87.63	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	145	22	89	2.04	2.29
	3k9uA00	85.26	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	13	83	3.20	3.85
	1qsmD00	85.13	CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2	3.40.630.30	152	15	91	3.02	3.32
	1s3zA00	84.91	Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase	3.40.630.30	147	17	89	3.19	3.58
	3fynA00	84.50	Uncultured bacteriumPutative integron gene cassette protein	3.40.630.30	149	13	89	3.51	3.91
	2fe7A00	84.07	Pseudomonas aeruginosaProbable N-acetyltransferase	3.40.630.30	154	12	84	2.44	2.88
	2ge3B00	83.87	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	14	83	3.16	3.81
	2i79D00	83.42	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	15	82	3.29	3.98
	2pdoA01	83.38	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	18	73	3.47	4.70
	2q7bA00	83.08	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	161	14	82	3.69	4.47
	3exnA00	83.00	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	7	85	3.47	4.04
	1vhsB00	82.96	Bacillus subtilisPhosphinothricin acetyltransferase [EC:2.3.1.183]Phosphonate and phosphinate metabolismPutative phosphinothricin acetyltransferase ywnH	3.40.630.30	155	16	85	3.30	3.87
	2r7hB00	82.91	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	14	84	3.26	3.85
	3g8wA00	82.84	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	12	83	2.92	3.50
	3fncA00	82.81	Listeria innocuaLin0611 protein	3.40.630.30	157	12	79	2.77	3.48
	3e0kA00	82.76	Arginine and proline metabolismVibrio parahaemolyticusAmino-acid N-acetyltransferase [EC:2.3.1.1]Amino-acid acetyltransferaseMetabolic pathways	3.40.630.30	143	12	77	2.65	3.41
	3d8pB00	82.71	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	10	82	4.02	4.89
	1gheA00	82.65	Tyrosine metabolismLimonene and pinene degradationAcetyltransferase1- and 2-Methylnaphthalene degradationPhenylalanine metabolism	3.40.630.30	166	12	80	2.93	3.66
	2fiaA00	81.90	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	15	78	3.09	3.91
	1y7rA00	81.66	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	20	75	2.80	3.69
	2i6cA00	81.58	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	154	12	79	3.17	3.98
	2atrA00	81.56	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	127	19	76	2.87	3.75
	2ae6A00	81.54	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	15	80	3.27	4.04
	1n71B00	81.50	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	15	72	3.03	4.17
	1q2yA00	81.48	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	17	79	3.75	4.71
	3eo4A00	81.32	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	12	84	4.09	4.83
	1qstA00	81.23	HAT A1Tetrahymena thermophila	3.40.630.30	160	10	79	3.90	4.91
	2r1iA01	80.91	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	11	77	2.48	3.19
	2q0yA01	80.60	Ralstonia eutropha JMP134GCN5-related N-acetyltransferase	3.40.630.30	125	14	73	3.26	4.41
	3blnA00	80.43	Bacillus cereus ATCC 10987Putative uncharacterized protein	3.40.630.30	139	11	78	3.61	4.57
	1sqhA02	80.35	Drosophila melanogasterCG14615	3.40.630.30	128	16	74	3.64	4.88
	2pr1A00	80.22	Uncharacterized N-acetyltransferase ylbPBacillus subtilis	3.40.630.30	152	11	83	4.11	4.93
	3fbuA00	80.21	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	13	78	3.34	4.23
	2fckA00	79.86	Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative	3.40.630.30	171	12	81	3.28	4.01
	3d3sA00	79.83	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	7	82	3.06	3.72
	1nslA00	79.81	Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF	3.40.630.30	173	11	81	3.08	3.78
	3gkrA02	78.83	Weissella viridescensFemX	3.40.630.30	165	7	76	3.38	4.43
	1yreC00	78.32	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	9	74	3.01	4.03
	2fl4A02	76.50	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	15	58	2.88	4.91

>pdb|1i12D00
SMSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDNKIMQYNPMVIVDKRTETVAATGNII
IERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK    

>pdb|1i12D00
SMSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDNEDKKIMQYNPMVIVDKRTETVAATG
NIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK