CATH Domain: 1hykA00 XML data for domain: 1hykA00

Molscript image for 1hykA00
1hykA00
PDB coordinates for domain 1hykA00

PDB 1hyk, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.760 Agouti Related Protein; Chain A
4.10.760.10 Agouti Related Protein; Chain A Gene3D
4.10.760.10.2
4.10.760.10.2.1
4.10.760.10.2.1.1
4.10.760.10.2.1.1.1
4.10.760.10.2.1.1.1.1

[top]
Segment boundaries for domain 1hykA00

Chopping figure for domain 1hykA00
DomainStart PDB ResidueStop PDB Residue
1hykA00 1 46

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.760.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1aggA00 78.07 Omega-agatoxin-Aa4bAgelenopsis aperta 4.10.40.10 48 15 91 4.11 4.48
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1hykA00
CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1hykA00
CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"