Set cath from cathlist by auto on 05 Mar 2006 19:33
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1hyhC01 | 21 | 168 |
| 1hyhC02 | 169 | 327 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.90.110.10.8.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2x0jA02 | 88.23 | 3.90.110.10 | 152 | 27 | 92 | 1.98 | 2.13 |
>pdb|1hyhC02 LLDTARMQRAVGEAFDLDPRSVSGYNLGEHGNSQFVAWSTVRVMGQPIVTLADAIDLAAIEEEARKGGFTVLNGKGYTSY GVATSAIRIAKAVMADAHAELVVSNRRDDMGMYLSYPAIIGRDGVLAETTLDLTTDEQEKLLQSRDYIQQRFDEIVD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"