CATH Domain: 1hw1A01 XML data for domain: 1hw1A01

Molscript image for 1hw1A01
1hw1A01
PDB coordinates for domain 1hw1A01

PDB 1hw1, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.10 "winged helix" repressor DNA binding domain Gene3D
1.10.10.10.9
1.10.10.10.9.1
1.10.10.10.9.1.1
1.10.10.10.9.1.1.1
1.10.10.10.9.1.1.1.1

Segment boundaries for domain 1hw1A01

Chopping figure for domain 1hw1A01
DomainStart PDB ResidueStop PDB Residue
1hw1A01 5 79
1hw1A02 80 230

Structural Neighbourhood (61 entries)

There are 61 matching structural neighberhood comparisons for CATH ID 1.10.10.10.9.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 61 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3by6C01 89.56 GntR family transcriptional regulatorOenococcus oeni PSU-1Transcriptional regulator, GntR family 1.10.10.10 77 13 89 1.92 2.14
3edpA01 89.33 Listeria innocuaLin2111 protein 1.10.10.10 75 21 96 3.66 3.81
3bwgB01 88.98 GntR family transcriptional regulator, transcriptional regulator of bglABacillus subtilisUncharacterized HTH-type transcriptional regulator yydK 1.10.10.10 68 19 90 1.90 2.10
2hs5A01 88.55 Rhodococcus jostii RHA1Probable transcriptional regulator, GntR family protein 1.10.10.10 67 23 89 1.83 2.05
2g7uA01 86.61 Rhodococcus opacusPutative regulator of catechol degradative operon 1.10.10.10 74 16 92 3.87 4.21
1sfuA00 86.02 Yaba-like disease virus34L protein 1.10.10.10 70 8 90 2.83 3.12
1qbjC00 85.41 CytoplasmNucleolusHomo sapiensDouble-stranded RNA-specific adenosine deaminaseBase conversion or substitution editing 1.10.10.10 66 21 85 2.31 2.71
1lvaA03 85.37 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 62 14 82 2.78 3.36
1z05A01 85.17 Vibrio choleraeTranscriptional regulator, ROK family 1.10.10.10 72 8 82 2.69 3.25
1ft9A02 84.85 Rhodospirillum rubrumCooA protein 1.10.10.10 79 16 86 3.22 3.74
1jhfA02 84.73 Repressor LexA [EC:3.4.21.88]TranscriptionDNA bindingLexA repressorTranscription repressor activity 1.10.10.10 69 17 88 4.28 4.86
1hw5A02 84.51 TranscriptionTranscription activator activityTranscription repressor activityCRP/FNR family transcriptional regulator, cyclic AMP receptor proteinCatabolite gene activator 1.10.10.10 68 17 80 2.86 3.58
2p8tA01 84.40 Pyrococcus horikoshiiPutative uncharacterized protein PH0730 1.10.10.10 75 9 78 2.90 3.69
2dtrA01 84.37 DtxR family transcriptional regulator, Mn-dependent transcriptional regulatorDiphtheria toxin repressorCorynebacterium diphtheriae 1.10.10.10 71 14 92 4.51 4.90
3c7jA01 84.35 Pseudomonas syringae pv. syringaeRegulatory protein GntR 1.10.10.10 87 28 77 2.65 3.44
1on2A01 84.01 Bacillus subtilisTranscriptional regulator mntR 1.10.10.10 72 15 92 4.28 4.65
1in4A02 83.94 Holliday junction DNA helicase RuvBThermotoga maritimaHomologous recombinationHolliday junction ATP-dependent DNA helicase ruvB 1.10.10.10 73 15 90 4.18 4.61
1w1wE00 83.79 Nuclear mitotic cohesin complexProtein acetylationChromatin bindingCohesin complex subunit SCC1Establishment of mitotic sister chromatid cohesion 1.10.10.580 70 5 85 3.24 3.80
1lvaA01 83.79 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 59 16 74 2.73 3.66
2ia2C01 83.77 Rhodococcus sp. DK17PcaR 1.10.10.10 60 15 80 2.52 3.15
2heoA00 83.76 Mus musculusLeft-handed Z-DNA bindingZ-DNA-binding protein 1 1.10.10.10 59 20 78 2.71 3.44
2ia2D01 83.69 Rhodococcus sp. DK17PcaR 1.10.10.10 57 14 76 2.77 3.64
3bz6A02 83.65 Hypothetical proteinPseudomonas syringae pv. tomatoUPF0502 protein PSPTO_2686 1.10.10.10 76 10 84 4.04 4.80
1ldjA06 83.61 Cullin-1Cell cycle arrestInduction of apoptosis by intracellular signalsUbiquitin mediated proteolysisWnt signaling pathway 1.10.10.10 68 13 74 2.64 3.54
2o0yB01 83.54 Rhodococcus jostii RHA1Transcriptional regulator 1.10.10.10 64 15 85 3.25 3.81
1mkmB01 83.49 Thermotoga maritimaTranscriptional regulator, IclR family 1.10.10.10 76 12 90 3.33 3.67
2jt1A00 83.40 PefI proteinSalmonella enterica subsp. enterica serovar Typhimurium 1.10.10.10 71 12 88 3.94 4.48
1lvaA02 83.31 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 69 10 81 3.11 3.82
3cuqB03 83.27 Homo sapiensVacuolar protein-sorting-associated protein 36ESCRT-II complex subunit VPS36Endocytosis 1.10.10.10 69 14 88 3.36 3.82
2hr3D02 83.24 Probable transcriptional regulatorPseudomonas aeruginosa 1.10.10.10 61 16 78 3.34 4.25
1lddA00 83.14 Mitotic sister chromatid segregationProtein ubiquitinationCyclin catabolic processMeiosis - yeastAnaphase-promoting complex subunit 2 1.10.10.10 74 9 84 2.71 3.23
1j5yA01 82.98 Thermotoga maritimaTranscriptional regulator, biotin repressor family 1.10.10.10 64 10 85 3.02 3.54
2ns0A00 82.72 Rhodococcus jostii RHA1Putative uncharacterized protein 1.10.10.10 82 12 80 3.01 3.74
2o0yC01 82.64 Rhodococcus jostii RHA1Transcriptional regulator 1.10.10.10 73 12 81 3.02 3.71
1cf7A00 82.64 Protein domain specific bindingTranscription factor bindingE2F transcription factor 4/5Transcription factor E2F4TGF-beta signaling pathway 1.10.10.10 67 4 85 3.03 3.55
1cf7B00 82.59 Protein domain specific bindingTranscription factor Dp-2Transcription cofactor activityHomo sapiens 1.10.10.10 82 10 75 2.43 3.21
3ctaA01 82.56 Riboflavin metabolismRiboflavin kinaseRiboflavin kinase, archaea type [EC:2.7.1.161]Thermoplasma acidophilum 1.10.10.10 84 9 82 3.87 4.71
2gauA02 82.50 Transcriptional regulator, Crp/Fnr familyPorphyromonas gingivalis 1.10.10.10 81 13 83 3.88 4.62
1lvaA04 82.16 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 60 16 80 3.07 3.84
1biaA01 81.76 Biotin metabolismDNA bindingBirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]Bifunctional protein birABiotin-[acetyl-CoA-carboxylase] ligase activity 1.10.10.10 64 18 84 4.10 4.88
2fnaA03 81.69 Sulfolobus solfataricusPutative uncharacterized protein 1.10.10.10 72 8 82 3.62 4.38
1hstA00 81.57 Histone H1/5Gallus gallusHistone H5 1.10.10.10 74 12 84 3.61 4.30
2hoeA01 81.13 Thermotoga maritimaTranscriptional regulator, XylR-related 1.10.10.10 57 22 69 2.41 3.48
1s3jA02 80.73 Bacillus subtilisUncharacterized HTH-type transcriptional regulator yusO 1.10.10.10 62 12 77 3.53 4.56
3cuqA02 80.56 ESCRT-II complex subunit VPS22Transcription factor bindingRegulation of transcription from RNA polymerase II promoterHomo sapiensVacuolar-sorting protein SNF8 1.10.10.10 81 17 85 3.94 4.63
1t6sB02 80.43 Chlorobaculum tepidumSegregation and condensation protein BSegregation and condensation protein B 1.10.10.10 77 8 85 3.98 4.64
3dfgA01 79.86 Xanthomonas campestris pv. campestrisRegulatory proteinRegulatory protein recX 1.10.10.10 48 12 62 2.27 3.62
1q1hA00 79.43 Sulfolobus solfataricusTranscription initiation factor TFIIE alpha subunitTranscription factor EBasal transcription factors 1.10.10.10 85 9 75 3.51 4.66
1u5tB01 78.86 Protein targeting to vacuoleVacuolar protein-sorting-associated protein 36Protein retention in Golgi apparatusUbiquitin bindingEndocytosis 1.10.10.10 85 9 75 3.38 4.49
1xb4B02 78.73 Protein targeting to vacuoleESCRT-II complex subunit VPS25Saccharomyces cerevisiaeESCRT II complexVacuolar protein-sorting-associated protein 25 1.10.10.10 75 14 84 3.79 4.51
1bbyA00 78.61 Basal transcription factorsGeneral transcription factor IIF subunit 2General RNA polymerase II transcription factor activityHomo sapiensTranscription initiation factor TFIIF beta subunit 1.10.10.10 69 5 85 3.59 4.21
3cuqD00 78.58 ESCRT-II complex subunit VPS25Homo sapiensVacuolar protein-sorting-associated protein 25Endocytosis 1.10.10.570 97 10 67 3.27 4.88
1u5tB02 78.35 Protein targeting to vacuoleVacuolar protein-sorting-associated protein 36Protein retention in Golgi apparatusUbiquitin bindingEndocytosis 1.10.10.10 69 17 82 3.45 4.17
3dfgA02 78.22 Xanthomonas campestris pv. campestrisRegulatory proteinRegulatory protein recX 1.10.10.10 46 8 61 2.75 4.48
1oyiA00 78.12 Vaccinia virusDouble-stranded RNA-binding protein 1.10.10.10 62 12 82 3.64 4.40
1d8jA00 77.53 Basal transcription factorsTranscription initiation factor IIE subunit betaTranscription initiation factor TFIIE beta subunitHomo sapiensProtein binding 1.10.10.10 81 5 82 4.04 4.88
3bqzA01 76.30 HTH-type transcriptional regulator qacRStaphylococcus aureus subsp. aureus Mu50 1.10.10.60 49 10 65 3.12 4.78
1ldkB03 76.11 Cullin-1Cell cycle arrestInduction of apoptosis by intracellular signalsUbiquitin mediated proteolysisWnt signaling pathway 1.10.10.10 83 5 74 3.72 4.98
1s6lA01 76.06 Alkylmercury lyaseEscherichia coli 1.10.10.10 52 7 69 3.30 4.76
2gtgA00 75.58 Proactivator polypeptideLipid transportGlycosphingolipid metabolic processEnzyme activator activityIntegral to membrane 1.10.225.10 78 6 74 3.69 4.96
3c18A03 74.78 Exiguobacterium sibiricum 255-15Putative uncharacterized protein 1.10.10.10 54 7 60 2.96 4.93
Displaying entries 1 to 61 (page 1 of 1)


Domain ATOM Sequence

>pdb|1hw1A01
AQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETSG    

Domain COMBS Sequence

>pdb|1hw1A01
MVIKAQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETSG    

Domain History Events (206)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1hw1A01 to 1.10.10.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1hw1A01 (from the previous chopping at "Sun Mar 5 16:48:16 2006") which was in 1.10.10.10 at the time the chain was unchopped.

Update comment by auto on 09 Jan 2007 11:44

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Jan 2007 07:38

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Jan 2007 03:38

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Jan 2007 23:42

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Jan 2007 20:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Jan 2007 15:37

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Jan 2007 11:38

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Jan 2007 07:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Jan 2007 03:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Jan 2007 23:26

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Jan 2007 15:42

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Jan 2007 11:44

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Jan 2007 07:34

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Jan 2007 03:46

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 06 Jan 2007 23:41

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Dec 2006 15:28

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Dec 2006 11:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Dec 2006 07:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Dec 2006 03:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 29 Dec 2006 23:25

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 29 Dec 2006 19:28

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 29 Dec 2006 15:28

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 29 Dec 2006 11:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 29 Dec 2006 07:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 29 Dec 2006 03:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 28 Dec 2006 23:25

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 28 Dec 2006 19:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 28 Dec 2006 15:28

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 28 Dec 2006 11:26

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 28 Dec 2006 07:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 28 Dec 2006 03:33

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 27 Dec 2006 23:24

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 27 Dec 2006 19:28

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 27 Dec 2006 15:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 27 Dec 2006 11:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 27 Dec 2006 07:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 27 Dec 2006 03:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 26 Dec 2006 23:25

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 26 Dec 2006 19:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 26 Dec 2006 15:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 26 Dec 2006 11:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 26 Dec 2006 07:33

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 26 Dec 2006 03:33

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 25 Dec 2006 23:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 25 Dec 2006 19:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 25 Dec 2006 15:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 25 Dec 2006 11:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 25 Dec 2006 07:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 25 Dec 2006 03:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 24 Dec 2006 23:33

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 24 Dec 2006 19:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 24 Dec 2006 15:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 24 Dec 2006 11:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 24 Dec 2006 07:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 24 Dec 2006 03:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 23 Dec 2006 23:34

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 23 Dec 2006 19:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 23 Dec 2006 15:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 23 Dec 2006 11:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 23 Dec 2006 07:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 23 Dec 2006 03:34

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 22 Dec 2006 23:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 22 Dec 2006 19:34

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 22 Dec 2006 15:44

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 22 Dec 2006 11:41

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 22 Dec 2006 07:37

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 22 Dec 2006 03:40

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 21 Dec 2006 23:36

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 21 Dec 2006 19:37

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 21 Dec 2006 15:35

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 21 Dec 2006 11:26

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 21 Dec 2006 07:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 21 Dec 2006 03:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 20 Dec 2006 23:25

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 20 Dec 2006 19:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 20 Dec 2006 15:37

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 20 Dec 2006 11:33

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 20 Dec 2006 07:37

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 20 Dec 2006 03:36

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 19 Dec 2006 23:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 19 Dec 2006 19:40

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 19 Dec 2006 15:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 19 Dec 2006 11:26

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 19 Dec 2006 07:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 19 Dec 2006 03:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 18 Dec 2006 23:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 18 Dec 2006 19:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 18 Dec 2006 15:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 18 Dec 2006 11:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 18 Dec 2006 07:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 18 Dec 2006 03:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 17 Dec 2006 23:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 17 Dec 2006 19:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 17 Dec 2006 15:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 17 Dec 2006 11:26

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 17 Dec 2006 07:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 17 Dec 2006 03:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 16 Dec 2006 23:33

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 16 Dec 2006 19:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 16 Dec 2006 15:29

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 16 Dec 2006 11:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 16 Dec 2006 07:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 16 Dec 2006 03:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 15 Dec 2006 23:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 15 Dec 2006 19:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 15 Dec 2006 15:37

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 15 Dec 2006 11:34

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 15 Dec 2006 07:33

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 15 Dec 2006 03:37

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 14 Dec 2006 23:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 14 Dec 2006 19:35

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 14 Dec 2006 15:49

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 14 Dec 2006 11:35

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 14 Dec 2006 07:34

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 14 Dec 2006 03:45

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 13 Dec 2006 23:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 13 Dec 2006 19:36

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 13 Dec 2006 15:38

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 13 Dec 2006 11:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 13 Dec 2006 07:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 13 Dec 2006 03:51

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 13 Dec 2006 02:34

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 12 Dec 2006 13:19

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 12 Dec 2006 09:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 12 Dec 2006 05:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 12 Dec 2006 01:21

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 11 Dec 2006 21:16

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 11 Dec 2006 17:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 11 Dec 2006 13:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 11 Dec 2006 09:16

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 11 Dec 2006 05:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 11 Dec 2006 01:21

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 10 Dec 2006 21:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 10 Dec 2006 17:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 10 Dec 2006 13:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 10 Dec 2006 09:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 10 Dec 2006 05:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 10 Dec 2006 01:23

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Dec 2006 21:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Dec 2006 17:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Dec 2006 13:22

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Dec 2006 09:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Dec 2006 05:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 09 Dec 2006 01:23

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Dec 2006 21:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Dec 2006 17:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Dec 2006 13:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Dec 2006 09:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Dec 2006 05:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 08 Dec 2006 01:25

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Dec 2006 21:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Dec 2006 17:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Dec 2006 13:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Dec 2006 09:19

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Dec 2006 05:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 07 Dec 2006 01:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 06 Dec 2006 21:24

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 06 Dec 2006 17:23

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 06 Dec 2006 13:20

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 06 Dec 2006 09:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 06 Dec 2006 05:21

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 06 Dec 2006 01:30

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 05 Dec 2006 21:26

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 05 Dec 2006 17:31

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 05 Dec 2006 13:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 05 Dec 2006 09:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 05 Dec 2006 05:19

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 05 Dec 2006 01:22

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 04 Dec 2006 21:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 04 Dec 2006 17:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 04 Dec 2006 13:15

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 04 Dec 2006 09:16

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 04 Dec 2006 05:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 04 Dec 2006 01:21

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 03 Dec 2006 21:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 03 Dec 2006 17:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 03 Dec 2006 13:21

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 03 Dec 2006 09:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 03 Dec 2006 05:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 03 Dec 2006 01:25

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 02 Dec 2006 21:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 02 Dec 2006 17:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 02 Dec 2006 13:17

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 02 Dec 2006 09:19

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 02 Dec 2006 05:21

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 02 Dec 2006 01:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 01 Dec 2006 21:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 01 Dec 2006 17:18

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 01 Dec 2006 13:16

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 01 Dec 2006 09:19

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 01 Dec 2006 05:25

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 01 Dec 2006 01:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Nov 2006 21:20

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Nov 2006 17:22

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Nov 2006 13:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Nov 2006 09:21

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Nov 2006 05:27

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 30 Nov 2006 01:32

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Update comment by auto on 29 Nov 2006 21:24

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Flow stage update by auto on 29 Nov 2006 21:24

Domain "1hw1A01" hits Domain "1e2xA01" (100% over 95.1807228915663%) which is currently in process

Flow stage update by auto on 29 Nov 2006 21:24

NW result present for Domain "1hw1A01"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "1hw1A01"

Flow stage update by auto on 28 Nov 2006 18:21

Beginning processing for Domain "1hw1A01"

Insertion by auto on 28 Nov 2006 17:25

Final ChopClose added based on similarity with "1e2xA"