Set cath from cathlist by auto on 05 Mar 2006 18:03
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 3 matching structural neighberhood comparisons for CATH ID 1.10.30.10.3.1.2.3.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2lefA00 | 86.67 | 1.10.30.10 | 86 | 29 | 91 | 2.56 | 2.79 | |
![]() |
1cktA00 | 86.49 | 1.10.30.10 | 71 | 25 | 87 | 2.01 | 2.30 | |
![]() |
1k99A00 | 82.77 | 1.10.30.10 | 91 | 22 | 84 | 3.90 | 4.61 |
>pdb|1hryA00 DRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"