Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1hp7A01 | 195 | 289 |
| 1hp7A02 | 23 | 194 |
| 1hp7A02 | 290 | 358 |
There are 2 matching structural neighberhood comparisons for CATH ID 2.30.39.10.16.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1imvA01 | 80.00 | 2.30.39.10 | 169 | 29 | 56 | 1.75 | 3.11 | |
![]() |
1k9oI02 | 78.87 | 2.30.39.10 | 161 | 26 | 59 | 2.24 | 3.80 |
>pdb|1hp7A01 ERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITK FLENEDRRSASLHLP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"