CATH Domain: 1hnjA01 XML data for domain: 1hnjA01

Molscript image for 1hnjA01
1hnjA01
PDB coordinates for domain 1hnjA01

PDB 1hnj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.47 Peroxisomal Thiolase; Chain A, domain 1
3.40.47.10 Gene3D
3.40.47.10.1
3.40.47.10.1.1
3.40.47.10.1.1.1
3.40.47.10.1.1.1.1
3.40.47.10.1.1.1.1.1

[top]
Segment boundaries for domain 1hnjA01

Chopping figure for domain 1hnjA01
DomainStart PDB ResidueStop PDB Residue
1hnjA01 1 171
1hnjA02 172 317

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.40.47.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1u6eA01 91.13 3-oxoacyl-[acyl-carrier-protein] synthase 3Beta-ketoacyl ACP synthase [EC:2.3.1.-]Mycobacterium tuberculosis 3.40.47.10 179 39 93 1.08 1.15
3gwaA01 90.39 Fatty acid biosynthesisMetabolic pathways3-oxoacyl-(Acyl-carrier-protein) synthase III3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]Burkholderia pseudomallei 1710b 3.40.47.10 172 34 97 1.39 1.43
1tedB01 84.07 Chalcone/stilbene synthase family proteinMycobacterium tuberculosis 3.40.47.10 210 25 80 3.01 3.72
1u0mA01 83.07 Putative polyketide synthaseStreptomyces coelicolor 3.40.47.10 202 22 82 2.78 3.36
1i88A01 81.91 Medicago sativaChalcone synthase 2 3.40.47.10 233 22 72 2.52 3.50
1tqyA02 80.58 3-oxoacyl-ACP synthase I [EC:2.3.1.-]Biosynthesis of type II polyketide backboneStreptomyces coelicolorActinorhodin polyketide putative beta-ketoacyl synthase 1 3.40.47.10 160 12 70 3.12 4.41
1ox0A02 79.80 Fatty acid biosynthesisMetabolic pathways3-oxoacyl-(Acyl-carrier-protein) synthase II3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]Streptococcus pneumoniae 3.40.47.10 145 11 66 3.03 4.59
1tqyB02 79.39 Actinorhodin polyketide putative beta-ketoacyl synthase 2Biosynthesis of type II polyketide backboneStreptomyces coelicolor3-oxoacyl-ACP synthase II [EC:2.3.1.-] 3.40.47.10 148 12 67 2.85 4.24
2vbaC02 78.07 Fatty acid biosynthesisMetabolic pathways3-oxoacyl-[acyl-carrier-protein] synthase 13-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]Fatty acid biosynthetic process 3.40.47.10 147 8 67 3.18 4.73
1tedA02 75.02 Chalcone/stilbene synthase family proteinMycobacterium tuberculosis 3.40.47.10 149 10 70 3.44 4.86
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1hnjA01
MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMAGIEKDQIGLIVVAT
TSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDG
AGAAVLAASEE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1hnjA01
MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMAGIEKDQIGLIVVAT
TSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDG
AGAAVLAASEE
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 06 Mar 2008 14:37

Assigning to "3.40.47.10" based on similarity with "1d9bA01"

Flow stage update by auto on 06 Mar 2008 14:35

No in_process hits for Domain "1hnjA01" ready to be processed

Update comment by auto on 06 Mar 2008 14:33

Domain "1hnjA01" hits Domain "1hn9B01" (100% over 99.4152046783626%) which is currently in process

Update comment by auto on 06 Mar 2008 14:31

Domain "1hnjA01" hits Domain "1hn9A01" (100% over 99.4152046783626%) which is currently in process

Update comment by auto on 06 Mar 2008 14:29

Domain "1hnjA01" hits Domain "1hndA01" (100% over 99.4152046783626%) which is currently in process

Update comment by auto on 06 Mar 2008 14:27

Domain "1hnjA01" hits Domain "1eblA01" (97.0588235294118% over 99.4152046783626%) which is currently in process

Update comment by auto on 06 Mar 2008 14:25

Domain "1hnjA01" hits Domain "1eblB01" (97.0588235294118% over 99.4152046783626%) which is currently in process

Update comment by auto on 06 Mar 2008 14:16

Domain "1hnjA01" hits Domain "1d9bB01" (100% over 99.4152046783626%) which is currently in process

Update comment by auto on 04 Sep 2007 14:06

Domain "1hnjA01" hits Domain "1d9bA01" (100% over 99.4152046783626%) which is currently in process

Flow stage update by auto on 04 Sep 2007 14:05

Domain "1hnjA01" hits Domain "1d9bA01" (100% over 99.4152046783626%) which is currently in process

Flow stage update by auto on 04 Sep 2007 14:04

NW result present for Domain "1hnjA01"

Flow stage update by auto on 04 Sep 2007 14:04

All required files are present for Domain "1hnjA01"

Flow stage update by auto on 03 Sep 2007 20:09

Beginning processing for Domain "1hnjA01"

Insertion by cuff on 03 Sep 2007 14:37

nice chopping