Insertion by sillitoe on 06 Mar 2006 15:33
HomCheck 'Assigned T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1hn0A01 | 25 | 234 |
| 1hn0A02 | 235 | 618 |
| 1hn0A03 | 619 | 899 |
| 1hn0A04 | 900 | 1021 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1hn0A01 ATSNPAFDPKNLMQSEIYHFAQNNPLADFSSDKNSILTLSDKRSIMGNQSLLWKWKGGSSFTLHKKLIVPTDKEASKAWG RSSTPVFSFWLYNEKPIDGYLTIDFGEKLISTSEAQAGFKVKLDFTGWRAVGVSLNNDLENVDSIRFKAPSNVSQGEIYI DRIMFSVDDARYQWSDYQVKTRLS
HomCheck 'Assigned T' domains
HomCheck 'Assigned T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"