Set cath from cathlist by auto on 05 Mar 2006 18:49
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1hm9A01 | 2 | 251 |
| 1hm9A02 | 252 | 440 |
There are 7 matching structural neighberhood comparisons for CATH ID 2.160.10.10.4.1.1.1.1 (SIMAX score < 5)
>pdb|1hm9A02 VSFVNPEATYIDIDVEIAPEVQIEANVILKGQTKIGAETVLTNGTYVVDSTIGAGAVITNSMIEESSVADGVTVGPYAHI RPNSSLGAQVHIGNFVEVKGSSIGENTKAGHLTYIGNCEVGSNVNFGAGTITVNYDGKNKYKTVIGDNVFVGSNSTIIAP VELGDNSLVGAGSTITKDVPADAIAIGRG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"