Set cath from cathlist by auto on 05 Mar 2006 19:35
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1hm9A01 | 2 | 251 |
| 1hm9A02 | 252 | 440 |
There are 4 matching structural neighberhood comparisons for CATH ID 3.90.550.10.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1jykA00 | 82.39 | 3.90.550.10 | 227 | 17 | 86 | 3.25 | 3.74 | |
![]() |
1i52A00 | 82.21 | 3.90.550.10 | 225 | 18 | 83 | 3.30 | 3.94 | |
![]() |
1eziA00 | 81.89 | 3.90.550.10 | 211 | 15 | 72 | 2.60 | 3.59 | |
![]() |
1e5kA00 | 77.33 | 3.90.550.10 | 188 | 15 | 73 | 3.21 | 4.36 |
>pdb|1hm9A01 SNFAIILAAGKGTRMKSDLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVGHKAELVEEVLAGQTEFVTQSEQLGTGHA VMMTEPILEGLSGHTLVIAGDTPLITGESLKNLIDFHINHKNVATILTAETDNPFGYGRIVRNDNAEVLRIVEQKDATDF EKQIKEINTGTYVFDNERLFEALKNINTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAESVMRR RINHKHMVNG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"