CATH Domain: 1hjrA00 XML data for domain: 1hjrA00

Molscript image for 1hjrA00
1hjrA00
PDB coordinates for domain 1hjrA00

PDB 1hjr, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.10 Gene3D
3.30.420.10.14
3.30.420.10.14.1
3.30.420.10.14.1.1
3.30.420.10.14.1.1.1
3.30.420.10.14.1.1.1.1

[top]
Segment boundaries for domain 1hjrA00

Chopping figure for domain 1hjrA00
DomainStart PDB ResidueStop PDB Residue
1hjrA00 1 158

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.420.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bzcA03 80.29 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.420.140 128 13 77 3.21 4.16
2hoeA02 77.20 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 146 8 81 4.04 4.95
1kcfB00 76.27 Crossover junction endodeoxyribonuclease activityDNA recombinationDNA bindingMitochondrial genome maintenanceMitochondrion 3.30.420.10 228 13 67 3.07 4.57
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1hjrA00
AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKL
GQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1hjrA00
AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKL
GQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQ
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"