CATH Domain: 1hfoA00 XML data for domain: 1hfoA00

Molscript image for 1hfoA00
1hfoA00
PDB coordinates for domain 1hfoA00

PDB 1hfo, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.429 Macrophage Migration Inhibitory Factor
3.30.429.10 Macrophage Migration Inhibitory Factor Gene3D
3.30.429.10.1
3.30.429.10.1.2
3.30.429.10.1.2.1
3.30.429.10.1.2.1.1
3.30.429.10.1.2.1.1.1

Segment boundaries for domain 1hfoA00

Chopping figure for domain 1hfoA00
DomainStart PDB ResidueStop PDB Residue
1hfoA00 1 113

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.429.10.1.2.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2xczA00 94.85 Possible ATLS1-like light-inducible proteinProchlorococcus marinus str. MIT 9313 3.30.429.10 114 34 100 1.26 1.26
1dptA00 92.64 D-dopachrome decarboxylaseDopachrome isomerase activityHomo sapiensD-dopachrome decarboxylase [EC:4.1.1.84]Protein binding 3.30.429.10 117 32 97 1.18 1.21
1mwwB00 85.12 Haemophilus influenzaeUncharacterized protein HI_1388.1 3.30.429.10 118 14 95 2.60 2.72
1u9dA00 83.63 Vibrio choleraePutative uncharacterized protein 3.30.429.10 120 6 87 2.74 3.13
3c6vA00 78.92 Aspergillus fumigatusPutative uncharacterized protein 3.30.429.10 140 12 78 3.47 4.42
Displaying entries 1 to 5 (page 1 of 1)


Domain ATOM Sequence

>pdb|1hfoA00
PIFTLNTNIKATDVPSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAFGTLMSIGGIEPSRNRDHSAKLF
DHLNTKLGIPKNRMYIHFVNLNGDDVGWNGTTF    

Domain COMBS Sequence

>pdb|1hfoA00
PIFTLNTNIKATDVPSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAFGTLMSIGGIEPSRNRDHSAKLF
DHLNTKLGIPKNRMYIHFVNLNGDDVGWNGTTF    

Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"