CATH Domain: 1hfoA00 XML data for domain: 1hfoA00

Molscript image for 1hfoA00
1hfoA00
PDB coordinates for domain 1hfoA00

PDB 1hfo, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.429 Macrophage Migration Inhibitory Factor
3.30.429.10 Macrophage Migration Inhibitory Factor Gene3D
3.30.429.10.1
3.30.429.10.1.2
3.30.429.10.1.2.1
3.30.429.10.1.2.1.1
3.30.429.10.1.2.1.1.1

[top]
Segment boundaries for domain 1hfoA00

Chopping figure for domain 1hfoA00
DomainStart PDB ResidueStop PDB Residue
1hfoA00 1 113

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.429.10.1.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2xczA00 94.85 Possible ATLS1-like light-inducible proteinProchlorococcus marinus str. MIT 9313 3.30.429.10 114 34 100 1.26 1.26
1dptA00 92.64 D-dopachrome decarboxylaseDopachrome isomerase activityHomo sapiensD-dopachrome decarboxylase [EC:4.1.1.84]Protein binding 3.30.429.10 117 32 97 1.18 1.21
1mwwB00 85.12 Haemophilus influenzaeUncharacterized protein HI_1388.1 3.30.429.10 118 14 95 2.60 2.72
1u9dA00 83.63 Vibrio choleraePutative uncharacterized protein 3.30.429.10 120 6 87 2.74 3.13
3c6vA00 78.92 Aspergillus fumigatusPutative uncharacterized protein 3.30.429.10 140 12 78 3.47 4.42
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1hfoA00
PIFTLNTNIKATDVPSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAFGTLMSIGGIEPSRNRDHSAKLF
DHLNTKLGIPKNRMYIHFVNLNGDDVGWNGTTF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1hfoA00
PIFTLNTNIKATDVPSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAFGTLMSIGGIEPSRNRDHSAKLF
DHLNTKLGIPKNRMYIHFVNLNGDDVGWNGTTF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"