Set cath from cathlist by auto on 05 Mar 2006 18:19
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1hbnA01 | 3 | 101 |
| 1hbnA02 | 102 | 276 |
| 1hbnA03 | 277 | 536 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1hbnA03 EPGGVPFGYLADICQSSRVNYEDPVRVSLDVVATGAMLYDQIWLGSYMSGGVGFTQYATAAYTDNILDDFTYFGKEYVED KYGLCEAPNNMDTVLDVATEVTFYGLEQYEEYPALLEDQFGGSRAAVVAAAAGCSTAFATGNAQTGLSGWYLSMYLHKEQ HSRLGFYYDLQDQGASNVFSIRGDEGLPLELRGPNYPNYAMNVGHQGEYAGISQAPHAARGDAFVFNPLVKIAFADDNLV FDFTNVRGEFAKGALRE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"