Set cath from cathlist by auto on 05 Mar 2006 18:30
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h9mA01 | 62 | 131 |
| 1h9mA02 | 1 | 61 |
| 1h9mA02 | 132 | 141 |
There are 50 matching structural neighberhood comparisons for CATH ID 2.40.50.100.2.1.1.1.1 (SIMAX score < 5)
>pdb|1h9mA02 MKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAKASNVILGVP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"