Domain assigned by cuff on 11 Mar 2009 20:04
homology match
CATH Domain: 1h6uA02
1h6uA02
PDB 1h6u, Chain A, Domain 2
Segment boundaries for domain 1h6uA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h6uA01 | 36 | 78 |
| 1h6uA02 | 79 | 240 |
| 1h6uA03 | 241 | 343 |
Structural Neighbourhood (3 entries)
There are 3 matching structural neighberhood comparisons for CATH ID 3.80.10.10.13.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 3 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1dceA03 | 83.27 | 3.80.10.10 | 136 | 20 | 78 | 3.26 | 4.16 | |
|
1w8aA00 | 81.44 | 3.80.10.10 | 189 | 20 | 77 | 3.43 | 4.41 | |
|
3cvrA01 | 79.65 | 3.80.10.10 | 231 | 17 | 63 | 2.13 | 3.35 |
[1]
Displaying entries 1 to 3 (page 1 of 1)
Domain ATOM Sequence
>pdb|1h6uA02 TTLSAFGTGVTTIEGVQYLNNLIGLELKDNQITDLAPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVT PLAGLSNLQVLYLDLNQITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASLPNLIEVHLK NN
Domain History Events (41)
Domain assignment manual match h by tronnberg on 16 Jan 2008 09:37
SSAP: 88.5 OV: 75 SEQ: 38. In the same family in SCOP (which has a slightly different chopping arrengment).
Homcheck review by tronnberg on 16 Jan 2008 09:37
SSAP: 88.5 OV: 75 SEQ: 38. In the same family in SCOP (which has a slightly different chopping arrengment).
Flow stage update by tronnberg on 16 Jan 2008 09:37
SSAP: 88.5 OV: 75 SEQ: 38. In the same family in SCOP (which has a slightly different chopping arrengment).
Homcheck allotment by tronnberg on 16 Jan 2008 09:35
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 16 Jan 2008 09:35
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 14 Jan 2008 18:36
Calculated SCOP results for 1h6uA02 and inserted them into the database.
Domain scan scop cath by auto on 14 Jan 2008 18:36
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 21 results for 1h6uA02
Flow stage update by auto on 17 Dec 2007 22:26
Retrieved PRC_PFAMCATH results for job ID SID5744053715480480 and results inserted.
Domain scan prc pfamcath by auto on 17 Dec 2007 22:26
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 1h6uA02
Update comment by auto on 17 Dec 2007 18:33
PRC_PFAMCATH job SID5744053715480480 is not yet finished.
Prc pfamcath submit by auto on 17 Dec 2007 18:32
The entry "1h6uA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 17 Dec 2007 18:32
The entry "1h6uA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 17 Dec 2007 18:22
Retrieved SSAP results for job ID SID1399926698848720 and results inserted.
Domain scan ssap cath by auto on 17 Dec 2007 18:22
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 304 results for 1h6uA02
Update comment by auto on 16 Dec 2007 22:39
SSAP job SID1399926698848720 is not yet finished.
Flow stage update by auto on 16 Dec 2007 22:29
The entry "1h6uA02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 16 Dec 2007 22:29
The entry "1h6uA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Dec 2007 22:27
Retrieved PRC results for job ID SID4137105305189474 and inserted them into the database.
Domain scan prc cath by auto on 16 Dec 2007 22:27
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 20 results for 1h6uA02
Update comment by auto on 16 Dec 2007 18:25
PRC job SID4137105305189474 is not yet finished.
Flow stage update by auto on 16 Dec 2007 18:21
The entry "1h6uA02" has been submitted to the PRC webservice.
Prc cath submit by auto on 16 Dec 2007 18:21
The entry "1h6uA02" has been submitted to the PRC webservice.
Flow stage update by auto on 16 Dec 2007 18:18
Retrieved HMM(SAM) results for job ID SID6921636561062848 and inserted them into the database.
Domain scan sam cath by auto on 16 Dec 2007 18:18
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 20 results for 1h6uA02
Update comment by auto on 16 Dec 2007 14:33
HMM(SAM) job SID6921636561062848 is not yet finished.
Sam cath submit by auto on 16 Dec 2007 14:29
The entry "1h6uA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 16 Dec 2007 14:29
The entry "1h6uA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 16 Dec 2007 14:27
Retrieved "1h6uA02" CATHEDRAL results for job ID SID5855243135127856 and inserted them into the database.
Domain scan cathedral cath by auto on 16 Dec 2007 14:26
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 50 results for 1h6uA02
Update comment by auto on 16 Dec 2007 10:35
"1h6uA02" CATHEDRAL job SID5855243135127856 is not yet finished.
Cathedral cath submit by auto on 16 Dec 2007 10:31
The entry "1h6uA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 16 Dec 2007 10:31
The entry "1h6uA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 16 Dec 2007 10:30
ScanList with 11652 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1h6uA02.scanlist" for "1h6uA02"
Write scan list by auto on 16 Dec 2007 10:30
Writing ScanList containing 11652 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1h6uA02.scanlist" for domain "1h6uA02"
Flow stage update by auto on 20 Jul 2007 15:45
No satisfactory AssignClose result found.
Flow stage update by auto on 14 Mar 2007 15:07
No in_process hits for Domain "1h6uA02" ready to be processed
Flow stage update by auto on 14 Mar 2007 15:06
NW result present for Domain "1h6uA02"
Flow stage update by auto on 14 Mar 2007 15:01
All required files are present for Domain "1h6uA02"
Flow stage update by auto on 14 Mar 2007 14:59
Beginning processing for Domain "1h6uA02"
Insertion by auto on 05 Mar 2006 23:21
Cut based on decision in database "DomChop" on "cathdb"
