Set cath from cathlist by auto on 05 Mar 2006 19:03
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h6dA01 | 74 | 212 |
| 1h6dA01 | 367 | 397 |
| 1h6dA02 | 213 | 366 |
| 1h6dA02 | 398 | 433 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.30.360.10.11.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3ceaC02 | 84.78 | 3.30.360.10 | 185 | 12 | 83 | 3.35 | 4.03 | |
![]() |
1tltA02 | 80.66 | 3.30.360.10 | 186 | 6 | 77 | 2.49 | 3.20 |
>pdb|1h6dA02 DPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSD PNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMGEEGMQ DVRLIQAIYEAARTGRPVNTDWGYVRQGGY
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"